Entry information : EcamKat[P]12 (EcC028427.10)
Entry ID 10595
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EcamKat[P]12 (EcC028427.10)
Name (synonym) EcamKat[P]12 (EcC028427.10)
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamKat[P]12
start..stop
S start..stop
EglKat[P]12 220 3.02e-75 2..151 1..126
EcamKat[P]11 187 2.09e-62 1..102 1..102
EcamKat[P]06 191 5.6e-62 1..168 1..237
EguKat[P]12 189 1.79e-61 1..102 1..102
EguKat[P]12 134 6.09e-40 103..182 165..244
Gene structure Fichier Exons


exon

Literature and cross-references EcamKat[P]12 (EcC028427.10)
Protein sequence: EcamKat[P]12 (EcC028427.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181
PWM (Da):   %s   20249.19  
PI (pH):   %s   6.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QTIIYVIGPIVLDDYHLVEKLANFDRERIPxSVVHARGACAKRFFEVTHDISHLTRADFLQAPGVQTPVTVRFSILIHERGGPETLRDPRGSPVNFCTREVRMHRDEEVRIVFEYFSSDA
LGSISCGQAIIEKENNFKQLGERCRSWAPDREWFICN*IDALSNPCVTxMRSTASGFHTGRR

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing; stops in frame, PS is missing, NNNN in DNA). Incorrect prediction from kazusa.
DNA
Send to BLAST
CDS
Send to BLAST