Entry information : EcamDiOx01 ( EcC038229.10)
Entry ID 10597
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-23 (Christophe Dunand)
Peroxidase information: EcamDiOx01 ( EcC038229.10)
Name (synonym) EcamDiOx01 ( EcC038229.10)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamDiOx01
start..stop
S start..stop
EgrDiOx01 1306 0 1..632 1..632
EglDiOx01 1296 0 1..628 1..629
EguDiOx01 1295 0 1..632 1..632
PtDiOx02 1098 0 1..632 1..632
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..93 93 N° 2 189..449 261 N° 3 1396..1545 150 N° 4 1728..1861 134
N° 5 2565..2778 214 N° 6 3200..3345 146 N° 7 3473..3700 228 N° 8 3899..4101 203
N° 9 4185..4428 244 N° 10 4548..4773 226  
join(1..93,189..449,1396..1545,1728..1861,2565..2778,3200..3345,3473..3700,3899. .4101,4185..4428,4548..4773)


exon

Literature and cross-references EcamDiOx01 ( EcC038229.10)
Protein sequence: EcamDiOx01 ( EcC038229.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   632
PWM (Da):   %s   72416.94  
PI (pH):   %s   8.23
Sequence 673
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALISVFSSLIHPQLRPMVSKMSLFDALIFLVIHAVDKLGLWHRLPVYMGLAYVGMRRHLHQRYNLIHVGSVDGKKYDTQAFNYRTADGRCNHPSDDVVGSRGTFFGRNMPPSTSTYGLMDPHPSVVASKLLARKEFIDNGKQFNMIACSWIQFMIHDWVDHMEETDQVEIEAPDEVAEKCPLKSFRFNKTKKVSTGSSHLKNGSLNIRTPWWDGSVIYGNDDNGERKVRTFKDGKLKISGDGLLEHDEKGIPISGDVRNSWAGFSLLQALFVKEHNTVCDMLKKYYPDLDDEKLYRHARLVTSAVIAKIHTIDWTVELLKTDTLLAGMRINWYGFLGKKFKDMFGHICGPILSGLVGLKRPRDHGVPYSLSEEFVSVYRMHSLLPDKLILRDVNSTILEHKCLPVAEEIPMREVVGRQGERRLSKIGMEQMMVSLGHQACGALSLWNYPSWMRNLVPQDVDGEDRPDSIDMAALEIYRDRERGIARYNEFRRNVLMIPISRWEDLTDDKQVIRALREVYGDDVEKLDLLVGLHAEKKIKGFAISETAFFIFLLIASRRLEADRFFTTNFNTQTYTEKGLEWVNKTETLKDVIDRHFPDMTRKYMRCSSAFAVWDSQPTPTSHIPLYLRHAP

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTGATCTCTGTTTTCTCTTCCCTCATCCATCCTCAGCTTCGCCCTATGGTCTCCAAAATGAGCCTCTTCGACGCGCTAATCTTCCTTGTACGTAACTCCCTCTCCCGCGAAAAGA
TGAGAGATGTGGTCGACGAGTGATCTGGCTTTTGATTTCTTACTGTTGTTTTGGGTGTTTCATGTAGGTGATACATGCGGTGGACAAGCTAGGATTATGGCACAGACTGCCGGTGTACAT
GGGGCTTGCCTACGTGGGGATGAGAAGGCACTTGCACCAGAGATATAATCTCATACACGTTGGTAGTGTTGACGGCAAAAAGTATGATACTCAGGCATTCAACTATCGGACGGCGGACGG
AAGGTGCAACCATCCGAGCGACGATGTCGTGGGTAGTCGAGGAACATTTTTTGGACGCAACATGCCTCCCTCCACTTCAACCTACGGG
GTAAGCATGTATTATAAGTCTTCTGATTTACT
CAGTCTATCAAATCAGAGAGGTTGAGTTTACGTATATCTGTTTCTGCTTCTTAAAATCAGAAGTTTACATTACTTTAAAAAGAACAGGCAACTGATAAAACTGTCCTTAATGCTCATTTG
CGACGGCTTACTAGTTGTCGCCTGTGTCACCTGTATACTTTCTTAATTGGAGCTACCGACGGTCCAGCGAGCCGGTCGACACCAGTGACTGCTATCGGAGCCATCCCTAAAAGCCGCATT
AGGGGCAGTTTTCCTGTCCCTAAACTCGCTTGAGAATAATATCCATAAAAGAGCTACTTTTTTTCTGTCATTTCCCGGTGGGGAGAGCAAAAACGTGCAAAGCTTTGATCATAGAAAGAC
ACCAATTCGATGACAAATTATTCTCTCCAGTGCAGGAAGATTTATTAAAATTTCAAGTTAAAGGAGGAGAATTTTTCTTTTTTATTGAAAAAAACTAAAGTAAATTTTCTATCATATCGG
AGAAGATGAAAATGCAACTTCAGAAAGTTACCCAACCACAAGCCATTAAAGAATTCCAGCAGTCTCTACTTTAGGTTTCTATCAATGGCCCACAGTCAAAATCTACATATGGACTGCCAT
GGCTGGTCAGAAAAAAAATTCCACTTCCCAAGGGCCTTATTCTCTTCATTTGGTTTACCATTAATTACTCAACTCATTAAGTGGGAGGCAGGCTACGGCCCTGTCACACCGCCCATGTCC
ACGGATTAGATTTGTTCAGTTTCTGTCTGAAGTGGCCTACAAATTTCATGAACTTGATTCTATCTCCGCTTGGAGAACAGCTGTCCAGTCTTATCTGTCAATCGTAAAGATTATTGTCTT
CTGATCGAATACCAAGTACAAGCATAGCCTGCAATACCAACAAAACTAATTTTGATTGTCTTCTTTTTCCACAGTTAATGGATCCACATCCATCTGTGGTGGCATCCAAGCTTTTGGCAA
GAAAAGAGTTCATTGACAATGGGAAGCAATTCAACATGATAGCATGCTCATGGATACAGTTCATGATTCATGACTGGGTTGATCACATGGAGGAAACTGATCAG
GTACTTAAAAAAAAAA
AAAAAAGAGTCCCCATAGCCTCTGTATTACACAAGGCACAGCTTGATATTTTGTAGGAAAACAACCTCAGAATATTTTGACAAACTCAAAATGGAGAAGTAGCCGAATGGATCCACCAGT
TGGGTCATCGCATTGAAGACTGAATGATCAATAATATCTTCGGCAGGTTGAAATTGAAGCACCTGATGAAGTTGCAGAGAAGTGTCCATTGAAGTCATTCCGATTTAACAAGACCAAGAA
AGTGTCAACTGGGTCATCTCATCTGAAAAATGGCTCTTTGAATATAAGGACCCCGTGGTG
GTAAGTTCCTGCGAACAGTATAGTAATTACTCAGGACTACTAAACTTTAGGCAGCCATTC
AAAAAACTCATGTCACTGAAAACAAGTCTTTGCAGCCATTTGATTCTTGATCCTTCTACGAGTTGAATGCAGAAAAAGATGGTGAAGAAAGATTTGGAAAAAAGATTAAGAAGCAATGTT
GTAGACAATATTTCAACCTCGCTGAGCCGTAAGACTCGGAATTCCCTGCTTTTTGCCTTCACCACCCGAACAAACTGAGAACTATGAACTTTCGTTATGCTGTCACCAGACAGATGTCCA
TATTTACAGATGTCTATATTTGTTCTCAGTTTGTTCTTAGATGCTGAAGAGTTCCTCAATAAAATGGAATGTGGCCTGGATAGAATAGTACTCTGAGGAAATTATGGAAACTACATACAG
ATATTCCAAAATTTCGTTTATATACGCTAAAATTTGCTTAAATGTAGGGTTTCATCTGAAATTGATGTCACTATGAAGTCTAGTACTTCCAGTAAGGCAACTAAGCCAATGACTGAAGGT
GTGATTTCATCTCAAAAGAAAAAAAAGTGGCTATCTGAGTAATGATTAGCTGAGCTTAGTCAAAACTTCACCAGTTAACTTGTTACTGCTCTAAGAGTTTTCTCGAAGAATTGACATGAA
GATGTGCATTTCATCAATGAGTTGTACATTGTAAACTACTTAGGGATGGAAGCGTGATATATGGAAATGACGATAATGGCGAGAGAAAAGTGAGGACCTTCAAAGATGGGAAGCTAAAGA
TTTCGGGAGATGGCCTCCTTGAACACGACGAGAAAGGGATTCCTATTTCAGGCGACGTCAGGAATAGCTGGGCTGGCTTTTCACTCTTGCAGGCCTTATTCGTCAAAGAACACAACACTG
TCTGCGATATGCTTAAA
GTAAGGCCTCTCTTCTCTTCCACCAATCCAATGAAAAGAACTTCCTTATTAAACAATGCTGATCCCTAGTTTTCGATCGCAATGATCTGGTGAAATGTCCATG
AACTCCTGATATTGTTGTTTCCAAATTCTTCAAGTCTATAAGGGCCGACACTTCTCTCGTCATTGTTATTTACTTGGACGAAAAGTTAGCTCTGAATACAACTGCACATCTTTTACCTGA
GGAACTATTATAGTACTAAGAAGCCTGACATCTTTGATCATCGTCAGAACCATATCTCATATAATTACCCTGGCTTCATGCGTGCTATCCTTAGGGTTGAGCGGTATCAACATAACATTT
CATTGAAAAAATTGCCGGCACTCATATGCCAAAGAAACTACAAGGATAGCTGATATTATGTACTTGTATATGTGTCAGAAATATTATCCAGATCTTGATGACGAGAAGCTCTATCGCCAT
GCCAGATTGGTAACTTCAGCTGTAATTGCCAAAATCCACACTATTGACTGGACTGTGGAGCTCCTGAAGACTGACACTCTTCTTGCTGGAATGAGGATAAACTG
GTAATAAAGAGAGAAA
AATGGATCTGATGATGAACGACTGGGGATTTACTAGTAGTTGTGCTAAAACTTACGCATAATTCTGTGATAATGCCGTACTTACTACTTACCATTATCATGCCTGGTTCAGGTATGGATT
TCTGGGGAAGAAATTTAAGGATATGTTCGGACATATATGCGGTCCGATATTGAGTGGATTAGTAGGTCTCAAAAGGCCGAGAGATCATGGAGTTCCATACTCACTCTCTGAGGAGTTTGT
CAGCGTCTATAGGATGCATTCACTCCTCCCGGATAAACTCATCCTGAGGGACGTCAACTCAACTATCCTGGAACACAAATGTCTGCCCGTTGCAGAAGA
GTAAGCATCTTACCATGCCAT
TTGCATCTAATTTCACTTTCTTCATGTTTGCTGTTACTGCCAAACTAAGGTCGCACCGACAAAAGCAAAGAACTTCGATCTCATGAAATAACAGATATATTGTCTTCTTCGGGAAATGGC
TTTCAATTTTACTTCTAGAGGGACTACCGTCACTAATTGTTCTAGGAAAATTACTAGGATTCCGATGCGGGAAGTGGTGGGACGACAAGGGGAGAGAAGACTCTCAAAGATTGGAATGGA
GCAGATGATGGTGTCACTAGGTCATCAGGCATGTGGGGCTCTCTCATTGTGGAATTATCCATCTTGGATGAGAAACCTTGTTCCTCAAGATGTCGATGGCGAAGATAGACCCGACTCAAT
CGACATGGCAGCTTTAGAAA
GTAACAGGACTACTCACCTCATTTCTTTCGCACTGCTATATCAACGTGACTGCACTCGAACTGACGCTCGCATATTGGGCCAGTTTACAGAGACAGGGAG
AGAGGTATCGCGCGGTACAACGAGTTCAGAAGAAACGTGCTGATGATCCCAATCAGCCGCTGGGAAGATTTGACTGATGATAAGCAAGTTATTCGAGCCTTGCGAGAAGTCTATGGAGAC
GATGTGGAGAAGCTTGACCTGTTGGTGGGTTTGCATGCAGAGAAGAAGATCAAGGGCTTTGCCATAAGTGAAACTGCTTTCTTCATCTTTCTACTGATTGCATCCAG
GTACCTCTCATAT
CCCCAACCCAATTAGGATACCCTGGAAGTGTTGACCCTTAATTCCATAACGTCCAGGCTGTGCCTCCTAACTTCTTGAACCCTCGTTCTTGATCATTTTTTTCCAGGCGGCTAGAAGCCG
ACCGGTTCTTTACAACCAACTTCAACACACAGACATACACAGAGAAAGGCCTGGAATGGGTAAATAAGACGGAAACATTGAAGGACGTCATAGATCGTCACTTCCCCGATATGACGAGGA
AGTATATGCGATGTTCAAGCGCATTCGCTGTATGGGATTCACAGCCAACGCCAACCTCACACATACCCCTCTATTTGCGTCATGCGCCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTGATCTCTGTTTTCTCTTCCCTCATCCATCCTCAGCTTCGCCCTATGGTCTCCAAAATGAGCCTCTTCGACGCGCTAATCTTCCTTGTGATACATGCGGTGGACAAGCTAGGAT
TATGGCACAGACTGCCGGTGTACATGGGGCTTGCCTACGTGGGGATGAGAAGGCACTTGCACCAGAGATATAATCTCATACACGTTGGTAGTGTTGACGGCAAAAAGTATGATACTCAGG
CATTCAACTATCGGACGGCGGACGGAAGGTGCAACCATCCGAGCGACGATGTCGTGGGTAGTCGAGGAACATTTTTTGGACGCAACATGCCTCCCTCCACTTCAACCTACGGG
TTAATGG
ATCCACATCCATCTGTGGTGGCATCCAAGCTTTTGGCAAGAAAAGAGTTCATTGACAATGGGAAGCAATTCAACATGATAGCATGCTCATGGATACAGTTCATGATTCATGACTGGGTTG
ATCACATGGAGGAAACTGATCAG
GTTGAAATTGAAGCACCTGATGAAGTTGCAGAGAAGTGTCCATTGAAGTCATTCCGATTTAACAAGACCAAGAAAGTGTCAACTGGGTCATCTCATC
TGAAAAATGGCTCTTTGAATATAAGGACCCCGTGGTG
GGATGGAAGCGTGATATATGGAAATGACGATAATGGCGAGAGAAAAGTGAGGACCTTCAAAGATGGGAAGCTAAAGATTTCGG
GAGATGGCCTCCTTGAACACGACGAGAAAGGGATTCCTATTTCAGGCGACGTCAGGAATAGCTGGGCTGGCTTTTCACTCTTGCAGGCCTTATTCGTCAAAGAACACAACACTGTCTGCG
ATATGCTTAAA
AAATATTATCCAGATCTTGATGACGAGAAGCTCTATCGCCATGCCAGATTGGTAACTTCAGCTGTAATTGCCAAAATCCACACTATTGACTGGACTGTGGAGCTCCTGA
AGACTGACACTCTTCTTGCTGGAATGAGGATAAACTG
GTATGGATTTCTGGGGAAGAAATTTAAGGATATGTTCGGACATATATGCGGTCCGATATTGAGTGGATTAGTAGGTCTCAAAA
GGCCGAGAGATCATGGAGTTCCATACTCACTCTCTGAGGAGTTTGTCAGCGTCTATAGGATGCATTCACTCCTCCCGGATAAACTCATCCTGAGGGACGTCAACTCAACTATCCTGGAAC
ACAAATGTCTGCCCGTTGCAGAAGA
GATTCCGATGCGGGAAGTGGTGGGACGACAAGGGGAGAGAAGACTCTCAAAGATTGGAATGGAGCAGATGATGGTGTCACTAGGTCATCAGGCAT
GTGGGGCTCTCTCATTGTGGAATTATCCATCTTGGATGAGAAACCTTGTTCCTCAAGATGTCGATGGCGAAGATAGACCCGACTCAATCGACATGGCAGCTTTAGAAA
TTTACAGAGACA
GGGAGAGAGGTATCGCGCGGTACAACGAGTTCAGAAGAAACGTGCTGATGATCCCAATCAGCCGCTGGGAAGATTTGACTGATGATAAGCAAGTTATTCGAGCCTTGCGAGAAGTCTATG
GAGACGATGTGGAGAAGCTTGACCTGTTGGTGGGTTTGCATGCAGAGAAGAAGATCAAGGGCTTTGCCATAAGTGAAACTGCTTTCTTCATCTTTCTACTGATTGCATCCAG
GCGGCTAG
AAGCCGACCGGTTCTTTACAACCAACTTCAACACACAGACATACACAGAGAAAGGCCTGGAATGGGTAAATAAGACGGAAACATTGAAGGACGTCATAGATCGTCACTTCCCCGATATGA
CGAGGAAGTATATGCGATGTTCAAGCGCATTCGCTGTATGGGATTCACAGCCAACGCCAACCTCACACATACCCCTCTATTTGCGTCATGCGCCTTAA

Retrieve as FASTA