Entry information : Ecam1CysPrx03-1
Entry ID 10601
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Li
Last annotation changes 2013-05-23 (Li)
Peroxidase information: Ecam1CysPrx03-1
Name Ecam1CysPrx03-1
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ecam1CysPrx03-1
start..stop
S start..stop
Egu1CysPrx03 452 8.69e-165 1..217 1..217
Egr1CysPrx03 452 8.69e-165 1..217 1..217
Ecam1CysPrx03-2 447 8.91e-163 1..217 1..217
Egl1CysPrx03-1 414 2.71e-150 19..216 1..198
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10601' 'join(1..118,223..371,739..885,1015..1251)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..118 116 N° 2 223..371 147 N° 3 739..885 145 N° 4 1015..1251 235
join(1..118,223..371,739..885,1015..1251)


exon

Literature and cross-references Ecam1CysPrx03-1
Protein sequence: Ecam1CysPrx03-1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   23890.32  
PI (pH):   %s   8.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTLGDTVPDLAVETTHGKMKLHDYIGGAWTVLFSHPGDFTPVCTTELGKMAAYAPEFERRGVKLLGLSCDEVESHKAWIKDIEAFPGAKVTYPIIADPNREIIKQLNMVEPEEKDAS
GKQVPSRALHIVGPDKK
IKLSFLYPASTGRNMDEVVRVLESLQRATKHKIATPCNWKPGEAVVISPSVSNEQAKEMFPQGYKTANLPSKKDYLRFT

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGCCTGACGCTCGGCGACACCGTCCCGGACCTCGCCGTCGAGACCACCCACGGCAAGATGAAGCTCCACGACTACATCGGCGGCGCCTGGACCGTCCTCTTCTCTCACCCCGCG
GTAACCGTCGTCGTCGTCGTCGTCTCTCCTTTTGCCCGACTCCGCATGTTTCGACGGCCCCGAGAAAAGGGAAGCCTTGTTCACCCACGACATCGCTTGCGCAGGGGATTTCACGCCGGT
GTGCACGACGGAGCTCGGGAAGATGGCGGCGTACGCGCCGGAGTTCGAGCGGCGAGGGGTGAAGCTCCTGGGCTTGTCCTGCGACGAGGTCGAGTCGCACAAGGCGTGGATCAAGGACAT
AGAGGCCTTCACC
CCGTCAGCTACTCTTCTCCCTATTAAACCTTTTTTTTTTATCACTTGGCACATATGTATATGTCTTGTAGGAACTTGCTTTTTGGGATTTTGATGTTGTGTTTTATC
TGGCTATGGTGATAGTATCCTTCAGAAAGAAAAAGAAAGAGAACTTATAGGAATGTGTAGTATTATGATTTAGTAGAGTGACCAAGGGAAGTCTCCTTAATCTTAGGCACAATTTGGGTA
GAATGAGGTGGTTTAATTGCGGGTCACAGGGCTGACTGTTCTGTTTCACATTTGAGATTGGGACCTTTGGCTTTTGTGCAATTTTCATTATTCCAATTTCGAGCCAACATCCTCAATGTC
GTGTTATTTGGTGGGGGTGTAGCCTGGTGCTAAGGTGACGTACCCGATAATCGCCGACCCGAATAGAGAGATAATCAAACAGCTCAACATGGTCGAGCCGGAGGAGAAAGACGCCTCCGG
GAAGCAAGTCCCTTCTAGAGCTCTGCACATCGTCGGTCCTGATAAGAAG
AGGTATACGTGCTCCTCTTAACTTTTCTATTCCGTATTAATCAAACTTTTATCGGATGAAACAAATTGCAT
AAACCAATGTCATCTCATGCATGTCGTTTTCGTTTTCACGATATAACATAAATTGTATAGATCAAGCTGAGTTTTCTGTACCCGGCGAGCACGGGGAGGAACATGGACGAGGTGGTGAGG
GTGCTGGAATCGCTGCAGAGGGCGACGAAGCACAAGATCGCCACCCCGTGCAACTGGAAGCCGGGGGAGGCAGTTGTCATCTCACCGTCCGTCTCCAACGAGCAGGCCAAGGAGATGTTC
CCGCAGGGCTACAAGACCGCCAATCTCCCGTCCAAGAAGGATTACCTCCGCTTCACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGCCTGACGCTCGGCGACACCGTCCCGGACCTCGCCGTCGAGACCACCCACGGCAAGATGAAGCTCCACGACTACATCGGCGGCGCCTGGACCGTCCTCTTCTCTCACCCCGGG
GATTTCACGCCGGTGTGCACGACGGAGCTCGGGAAGATGGCGGCGTACGCGCCGGAGTTCGAGCGGCGAGGGGTGAAGCTCCTGGGCTTGTCCTGCGACGAGGTCGAGTCGCACAAGGCG
TGGATCAAGGACATAGAGGCCTTCACC
CCTGGTGCTAAGGTGACGTACCCGATAATCGCCGACCCGAATAGAGAGATAATCAAACAGCTCAACATGGTCGAGCCGGAGGAGAAAGACGCC
TCCGGGAAGCAAGTCCCTTCTAGAGCTCTGCACATCGTCGGTCCTGATAAGAAG
ATCAAGCTGAGTTTTCTGTACCCGGCGAGCACGGGGAGGAACATGGACGAGGTGGTGAGGGTGCTG
GAATCGCTGCAGAGGGCGACGAAGCACAAGATCGCCACCCCGTGCAACTGGAAGCCGGGGGAGGCAGTTGTCATCTCACCGTCCGTCTCCAACGAGCAGGCCAAGGAGATGTTCCCGCAG
GGCTACAAGACCGCCAATCTCCCGTCCAAGAAGGATTACCTCCGCTTCACT

Retrieve as FASTA