Entry information : EcamGPx07 ( EcC065728.10)
Entry ID 10617
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EcamGPx07 ( EcC065728.10)
Name (synonym) EcamGPx07 ( EcC065728.10)
Class Plant glutathione peroxidase     [Orthogroup: Gpx2001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamGPx07
start..stop
S start..stop
EgrGPx07 226 5.35e-77 1..121 119..244
EguGPx07 214 1.52e-72 1..121 78..203
EgrGPx06 215 2.02e-72 1..121 125..250
EguGPx06 214 4.64e-72 1..121 125..250
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10617' 'join(2..62,241..353,500..658,747..776)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2..62 59 N° 2 241..353 111 N° 3 500..658 157 N° 4 747..776 28
join(2..62,241..353,500..658,747..776)


exon

Literature and cross-references EcamGPx07 ( EcC065728.10)
Protein sequence: EcamGPx07 ( EcC065728.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   120
PWM (Da):   %s   13223.68  
PI (pH):   %s   4.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GLTNSNYTELSQIYEKYKNQGLEILAFPCNQFGAQEPGTNEEILEFACARFKAECPFVDVNGENAAPLYKFLKSSKGGLFGDNIK*NFSKFLIDKEGNVDAPTTSPLSIEKDIKKLLGIA

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (5' end is missing due to the ending of contig).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGACTGACCAATTCAAATTACACCGAACTCAGTCAGATCTATGAGAAATACAAGAATCAAGAGGTCTCGTATGCCCTCCCCTGGTCCTGATATCCCATCGTATCTCGTGTGCCAGTGGAA
TACTGGCCTTAAAATGATAATAAACATATATTGTTTCAGAAATAACAATTGGTTATTGGTATCACTTGGCATGTGGAGATTCTAGAAAACTTAAAGAGGATGTCACTCTGATGCGATGCA
GGCTTGGAGATATTAGCATTCCCGTGCAACCAGTTTGGAGCTCAGGAGCCAGGGACAAATGAGGAGATCCTAGAATTTGCTTGCGCTCGATTCAAAGCTGAATGTCCATTTTGGGGTAAT
GTAAAAGAAATACATGACGTCCTTCTTTGACGGTGATGGAGTTGTATCTGCAGTTCCTTCATATTTCCTGGTGACTGCTAATTTGCAGTTTGAGTTATAAAAAATGAAATGAGGATGAAG
AATCTGATTGCTTTTTCTATAGGTTGATGTGAATGGTGAAAATGCTGCTCCTCTTTACAAGTTCCTGAAATCAAGCAAGGGAGGACTCTTTGGGGATAACATTAAGTAGAACTTCTCCAA
GTTCCTCATCGATAAAGAAGGAAATGTCGATGCCCCCACTACTTCTCCTCTTAGCATTGAG
AGGTAAGACTCTGATCGGCAACGTTCAAAGTTGAAGTGTGTTGACTTCTTTGGCTATTT
GACGGAGGCATCGCAGTTGTTCTTAATGCAGAAGGACATCAAGAAACTGTTGGGAATAGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGACTGACCAATTCAAATTACACCGAACTCAGTCAGATCTATGAGAAATACAAGAATCAAGGCTTGGAGATATTAGCATTCCCGTGCAACCAGTTTGGAGCTCAGGAGCCAGGGACAAAT
GAGGAGATCCTAGAATTTGCTTGCGCTCGATTCAAAGCTGAATGTCCATTTTGG
GTTGATGTGAATGGTGAAAATGCTGCTCCTCTTTACAAGTTCCTGAAATCAAGCAAGGGAGGACTC
TTTGGGGATAACATTAAGTAGAACTTCTCCAAGTTCCTCATCGATAAAGAAGGAAATGTCGATGCCCCCACTACTTCTCCTCTTAGCATTGAG
AAGGACATCAAGAAACTGTTGGGAATA
GCA

Retrieve as FASTA