Entry information : ZmaPrx10 ( Zosma538g00010 [2.2])
Entry ID 10620
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2016-04-08 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-08 (Achraf Jemmat)
Peroxidase information: ZmaPrx10 ( Zosma538g00010 [2.2])
Name (synonym) ZmaPrx10 ( Zosma538g00010 [2.2])
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Zosteraceae Zostera
Organism Zostera marina    [TaxId: 29655 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmaPrx10
start..stop
S start..stop
ZmaPrx38 528 0 1..318 1..319
PotacuPrx53 475 8.44e-171 6..317 9..316
PtaPrx18 443 4.01e-158 1..318 7..319
PabPrx111 442 6.78e-158 12..317 10..315
Gene structure Fichier Exons


exon

Literature and cross-references ZmaPrx10 ( Zosma538g00010 [2.2])
DNA ref. Phytozome 12:   scaffold_538 (21293..20085)
Cluster/Prediction ref. Phytozome Gene 12:   33174283
Protein sequence: ZmaPrx10 ( Zosma538g00010 [2.2])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   33774.35 (31211.1) Transmb domain:   %s   i148-165o
PI (pH):   %s   4.64 (4.64) Peptide Signal:   %s   cut: 24 range:24-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSNVLVTLFLFSFSFFSVPSAADLSASFYETSCPDALSTIKSAVVSAVSKEKRMGASLLRLHFHDCFVNGCDGSVLLDDTSTFTGEKTAPPNNNSLRGFDVIDTIKSDVESVCAQTVSC
ADIVAVAARDSIVALGGPNYDVLLGRRDSTTASFAAAKSDIPPPSSSLSSLISSFSVKGLSTNDMIALSGAHTIGKARCVSFRPHIYNDTNINDSYAEKLQENCPESGDDNNLASLDVST
DDVFDNYYYKNLKVEKGLLHSDQVLYNNGSADSQVSKYSSDSAQFFSDFTAAMINMGNISPLTGSSGQIRTNCRKAN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
CDS
Send to BLAST