Entry information : EcamKat13 (EcS580411.10)
Entry ID 10621
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2012-02-29 (Qiang Li)
Sequence status partial
Reviewer Li
Last annotation changes 2013-05-23 (Li)
Peroxidase information: EcamKat13 (EcS580411.10)
Name (synonym) EcamKat13 (EcS580411.10)
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamKat13
start..stop
S start..stop
EgrKat03 213 3.12e-69 1..103 390..492
EcamKat03 213 3.25e-69 1..103 386..488
PtKat01 199 1.14e-63 1..103 390..492
PdelKat01 199 1.14e-63 1..103 390..492
Gene structure Fichier Exons


exon

Literature and cross-references EcamKat13 (EcS580411.10)
Protein sequence: EcamKat13 (EcS580411.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   103
PWM (Da):   %s   12247.32  
PI (pH):   %s   10.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
INYFPSRYDPVRHAERYPIPTAMLTGKREKTIIEKENNFKQPGERYRSWTPDRQERFICRWIDALSDPRVTHEIRSIWISYWSADKSLGQKLASRLNVRTSI*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa. (PS)
DNA
Send to BLAST
CDS
Send to BLAST