Entry information : EcamGPx05 ( EcS722937.10)
Entry ID 10629
Creation 2012-02-29 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-02-14 (Christophe Dunand)
Peroxidase information: EcamGPx05 ( EcS722937.10)
Name (synonym) EcamGPx05 ( EcS722937.10)
Class Plant glutathione peroxidase     [Orthogroup: Gpx2008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamGPx05
start..stop
S start..stop
EgrGPx05 329 9.45e-118 1..165 1..165
EguGPx05 326 1.77e-116 1..165 1..165
EglGPx05 316 7.17e-113 17..174 1..157
EgrGPx06 289 1.07e-100 1..165 83..247
Gene structure Fichier Exons


exon

Literature and cross-references EcamGPx05 ( EcS722937.10)
Protein sequence: EcamGPx05 ( EcS722937.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174 (327)
PWM (Da):   %s   19465.81 (34924.7)  
PI (pH):   %s   9.06 (6.76) Peptide Signal:   %s   cut: 30 range:30-356
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSQSQKASVHDFTVKDARGNDVNLSQYRGKVLLIVNVASQCGLTNSNYTELSKLYEKYRNGLEILAFPCNQFGSQEPGTNEQIQELACTRFKAEYPVFSVDVNGANADPLYKHLKSSKGGFFGDGIKWNFSKFLVDKEGNVVNRYAPTTSPLSFEVKV
TERLFRMPYIPNP*

Retrieve as FASTA  
Remarks Partial sequence from genomic last exon is missing). Incorrect prediction from kazusa.
DNA
Send to BLAST
CDS
Send to BLAST