Entry information : EcamGPx09
Entry ID 10637
Creation 2012-03-01 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Li
Last annotation changes 2013-05-23 (Li)
Peroxidase information: EcamGPx09
Name EcamGPx09
Class Plant glutathione peroxidase     [Orthogroup: Gpx2002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamGPx09
start..stop
S start..stop
EglGPx09 320 1.57e-114 1..160 1..160
EguGPx09 320 1.72e-114 1..160 1..160
EgrGPx09 319 4.89e-114 1..160 1..160
GaGPx05 293 6.67e-104 1..160 1..160
Gene structure Fichier Exons


exon

Literature and cross-references EcamGPx09
Protein sequence: EcamGPx09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   160
PWM (Da):   %s   17764.08 Transmb domain:   %s   i7-29o
PI (pH):   %s   9.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASQSVPEKSIHEFTVKDSRGKDFDLSAYKGKVLLVVNVASKCGFTNSNYTQLTELYNKYKDGLEILAFPCNQFLKQEPGTSQDAQEFACTRFKAEYPIFHVRVNGPDTAPVYKFLKAS
KSGFLGSGIKWNFTKFLVDKEGHVLSRYSPTTSPLAIE

Retrieve as FASTA  
Remarks Partial sequence from kazusa. No prediction. Short 3' end is missing.
DNA
Send to BLAST
CDS
Send to BLAST