Entry information : OsPrx56(LOC_Os04g53640)
Entry ID 1066
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx56(LOC_Os04g53640)
Name OsPrx56(LOC_Os04g53640)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer Acid treatment
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx56
start..stop
S start..stop
BdiPrx132 598 0 1..328 1..328
SiPrx50 547 0 1..328 1..347
SbPrx94 546 0 1..328 4..347
ZmPrx140 528 0 1..328 1..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32004823..32005038 216 N° 2 32005127..32005315 189 N° 3 32005538..32005706 169 N° 4 32006328..32006740 413
join(32004823..32005038,32005127..32005315,32005538..32005706,32006328..32006740 )


exon

Literature and cross-references OsPrx56(LOC_Os04g53640)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1N7
DNA ref. GenBank:   NC_008397.1 (32004823..32006737)
Protein sequence: OsPrx56(LOC_Os04g53640)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (306)
PWM (Da):   %s   36125.29 (33601.9)  
PI (pH):   %s   8.38 (8.20) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPYRLLFGFVLSLVLQFSLVLSNPPGLNIGFYQYTCPKAEVIVRDEMTKIISRVPSLAGPLLRMHFHDCFVNGCDGSILLDSTPGSPSEKESIPNLSLRGFGTIDRVKAKLEQACPGVVSCADILALVARDVVFLTKGPHWEVPTGRRDGTRSVKDDAVNNLPPPFFDATRNLYQFFIPKGLDAKDQVVLLGGHTLGTSHCSSFASRLYNFSGMMMADPTLDKYYVPRLKSKCQPGDKTTLVEMDPGSFRTFDTSYYRHIARGRALFTSDETLMLDPFTRGYILRQAGVAGYPAEFFADFAASMVKMGNMQVLTGAQGEIRKHCAFVN

Retrieve as FASTA  
Remarks chromosome 4. No ESTs. TC284038
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTACAGACTCCTCTTCGGATTTGTCCTTTCTCTTGTCCTACAGTTCTCCTTAGTATTATCCAATCCACCAGGGCTAAACATTGGCTTTTACCAATACACATGTCCAAAAGCAGAG
GTCATTGTTCGTGATGAGATGACCAAGATCATATCCCGAGTTCCAAGTCTCGCAGGCCCTCTACTTCGCATGCATTTCCATGATTGTTTTGTGAAT
GTATGCATACTGCTTACCATGCTC
TGAGCTGTTTTGATTTTGAATTGAGTTTATCCTACTAAGCTATGTGCCTCTATGTGTTTTGCAGGGTTGCGATGGCTCTATACTTCTGGATAGCACACCAGGATCACCATCTGAGAAGGA
ATCAATACCAAACCTCAGTCTGCGAGGTTTTGGCACAATAGACCGTGTCAAAGCTAAGCTGGAGCAAGCCTGCCCTGGAGTTGTGTCCTGTGCTGATATCCTTGCTCTGGTAGCCAGAGA
TGTTGTCTTCTTG
GTAAGAACTAGCTTCCATGTTCATTAATCTTAGTTCATTCTTTAGTTAGAAAAGTTAGTATAGTTTGGCTAAGTGGTGAGAATTGGCTGTTTTAGGCCGACAATAGT
GGAAAACCACACAGTTTGATTTTCACCATATTCTACGTGGCTATTGGATTTCTTGCTGCTTACAGTAACTAGAACTATAGTTGAGAAAAGTCCCTATTCTTCCCTTGTGCAACAGACCAA
AGGGCCTCACTGGGAAGTTCCAACTGGGCGGAGGGATGGGACAAGATCAGTGAAGGATGATGCTGTGAACAACCTCCCTCCCCCCTTCTTCGATGCCACGCGGAACTTGTATCAATTCTT
CATCCCAAAGGGCCTTGACGCAAAGGATCAGGTGGTTCTGCTAG
GTATATACTATTCTTCACTAACTTCAATGTTTAATCTTCATAGACTAGCTCCCTAGATGATTTATACTGTACTTAC
TGAAAGTTGCAACTCTCGGTTCTGTTGCCTGTGCTCCTTTTAAACACTCTGCTGATCCCGATATATCCCAGTAGCATTCTCCAATAAAGGTGATCACTTATTTAATTACTATACAACTTG
TTAATAAAGGAAGGTATCATATGCGCATACCAAGTCAACAAAATGGGAAGTACAAAACTATGTGGTTCTTAGTTCTAATCACATGGCACAGTACAGAACCAAGCCAGGAGACCAAGACCA
CTTTATCCTCAAACACAGCATAGCTCTTTATTCGAGTGGTCAAAACATCGTTTCCTGTTCAGCACCATACTCATTTGTGCACTTGCAAAATTCATGGTTTTAAATAGCGGGTTAAGATAT
TTAGCGATTGACCTTCTCAAACAGCTATAGCGAACTTAATGGAGCTATAGTGGCTAAGACTCTTCTCAAACAGCTATAGCCAGAGATTCAAAACCATGGCAAAATTGCAATCCAAACTTG
TTTAATTACCAAGAACTCATCACAAATGTGCATATGCAATTTGAGAAGTGACACATTGTTCACAGGTGGGCACACTCTTGGAACCTCCCATTGTTCATCCTTCGCCAGCCGGCTGTACAA
CTTCAGCGGCATGATGATGGCCGACCCGACGCTGGACAAGTACTACGTGCCGAGGCTGAAGAGCAAGTGCCAGCCCGGCGACAAGACGACGCTGGTGGAGATGGACCCGGGGAGCTTCAG
GACGTTCGACACCAGCTACTACAGGCACATCGCCAGGGGCAGGGCGCTCTTCACCTCCGACGAGACGCTCATGCTCGACCCTTTCACCAGGGGCTACATCCTCCGCCAGGCCGGCGTCGC
CGGCTACCCGGCGGAGTTCTTCGCCGACTTCGCGGCGTCCATGGTGAAGATGGGGAACATGCAGGTGCTCACCGGCGCCCAGGGGGAGATCAGGAAGCACTGTGCCTTTGTGAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTACAGACTCCTCTTCGGATTTGTCCTTTCTCTTGTCCTACAGTTCTCCTTAGTATTATCCAATCCACCAGGGCTAAACATTGGCTTTTACCAATACACATGTCCAAAAGCAGAG
GTCATTGTTCGTGATGAGATGACCAAGATCATATCCCGAGTTCCAAGTCTCGCAGGCCCTCTACTTCGCATGCATTTCCATGATTGTTTTGTGAAT
GGTTGCGATGGCTCTATACTTCTG
GATAGCACACCAGGATCACCATCTGAGAAGGAATCAATACCAAACCTCAGTCTGCGAGGTTTTGGCACAATAGACCGTGTCAAAGCTAAGCTGGAGCAAGCCTGCCCTGGAGTTGTGTCC
TGTGCTGATATCCTTGCTCTGGTAGCCAGAGATGTTGTCTTCTTG
ACCAAAGGGCCTCACTGGGAAGTTCCAACTGGGCGGAGGGATGGGACAAGATCAGTGAAGGATGATGCTGTGAAC
AACCTCCCTCCCCCCTTCTTCGATGCCACGCGGAACTTGTATCAATTCTTCATCCCAAAGGGCCTTGACGCAAAGGATCAGGTGGTTCTGCTAG
GTGGGCACACTCTTGGAACCTCCCAT
TGTTCATCCTTCGCCAGCCGGCTGTACAACTTCAGCGGCATGATGATGGCCGACCCGACGCTGGACAAGTACTACGTGCCGAGGCTGAAGAGCAAGTGCCAGCCCGGCGACAAGACGACG
CTGGTGGAGATGGACCCGGGGAGCTTCAGGACGTTCGACACCAGCTACTACAGGCACATCGCCAGGGGCAGGGCGCTCTTCACCTCCGACGAGACGCTCATGCTCGACCCTTTCACCAGG
GGCTACATCCTCCGCCAGGCCGGCGTCGCCGGCTACCCGGCGGAGTTCTTCGCCGACTTCGCGGCGTCCATGGTGAAGATGGGGAACATGCAGGTGCTCACCGGCGCCCAGGGGGAGATC
AGGAAGCACTGTGCCTTTGTGAATTAG

Retrieve as FASTA