Entry information : MlpLDS01
Entry ID 10661
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: MlpLDS01
Name MlpLDS01
Class Linoleate diol synthase (PGHS like)    [Orthogroup: LDS001]
Taxonomy Eukaryota Fungi Basidiomycota Melampsoraceae Melampsora
Organism Melampsora laricis-populina    [TaxId: 203908 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MlpLDS01
start..stop
S start..stop
MlpLDS03 1305 0 2..1158 5..1083
MlpLDS02 1031 0 7..793 2..825
ScomLDS02 464 5.5e-145 98..923 61..850
PplLDS02 440 6.53e-137 128..879 1..718
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10661' 'join(2136443..2136610,2136676..2137002,2137092..2137377,2137451..2137738,2137816..2137988,2138086..2138212,2138294..2138328,2138390..2138402,2138493..2138590,2138678..2138892,2138989..2139085,2139174..2139318,2139393..2139424,2139497..2139606,2139677..2139714,2139783..2139941,2140001..2140047,2140112..2140302,2140380..2140454,2140519..2140639,2140707..2141183,2141247..2141319,2141400..2141629)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2136443..2136610 166 N° 2 2136676..2137002 325 N° 3 2137092..2137377 284 N° 4 2137451..2137738 286
N° 5 2137816..2137988 171 N° 6 2138086..2138212 125 N° 7 2138294..2138328 33 N° 8 2138390..2138402 11
N° 9 2138493..2138590 96 N° 10 2138678..2138892 213 N° 11 2138989..2139085 95 N° 12 2139174..2139318 143
N° 13 2139393..2139424 30 N° 14 2139497..2139606 108 N° 15 2139677..2139714 36 N° 16 2139783..2139941 157
N° 17 2140001..2140047 45 N° 18 2140112..2140302 189 N° 19 2140380..2140454 73 N° 20 2140519..2140639 119
N° 21 2140707..2141183 475 N° 22 2141247..2141319 71 N° 23 2141400..2141629 228  
join(2136443..2136610,2136676..2137002,2137092..2137377,2137451..2137738,2137816 ..2137988,2138086..2138212,2138294..2138328,2138390..2138402,2138493..2138590,21 38678..2138892,2138989..2139085,2139174..2139318,2139393..2139424,2139497..21396 06,2139677..2139714,2139783..2139941,2140001..2140047,2140112..2140302,2140380.. 2140454,2140519..2140639,2140707..2141183,2141247..2141319,2141400..2141629)


exon

Literature and cross-references MlpLDS01
DNA ref. JGI genome:   scaffold_5 (2136443..2141629)
EST ref. GenBank:   GR811534.1 [3' end]
Cluster/Prediction ref. JGI gene:   76882
Protein sequence: MlpLDS01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   1174 (337)
PWM (Da):   %s   131140.88 (35359.9)  
PI (pH):   %s   7.06 (4.76) Peptide Signal:   %s   cut: 22 range:22-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTPTRPPSRYAAEPKPGEALLQSAGYTHLLLVGQAKDLPTLSASPVWRKASQLQETIGSVSHYLFSRGSSNSGLNNEDEVALTDSKTPTSLIFLSVQQLLSGRIPENLSMIINILSSVG
KPLDDRKMQLEDVVGWLATSGRKNQHAPNKMVNDVQGQFIDILWNDLSHPSTVDLNPKHRFRTPDGRNNNIIGSPFLGAANQPYARSVKALHPRAPYVAEPEEMFDSILRRPEGFEGFVP
HPAGISSLLFGFANIIIHDIFWTNTGPEVKGPGSDTDSNQYGDSGNGSSRASQWQNLTSSYLSLDPLYGVGQEEQDKIRNKEDLGRGLLYNDTFASSRLLVMPPASCALLVIFSRNHNRV
AKRLLEINERKTWTADLEKLSPEQLQQQDDEIFGTARLINCGYYVEMILHDYLSAILNTTQADSDWALDPRAPIKSILGSTPKATGNSVTVEFNSLYRWHAPMSWSQSKWIEKWEDVNHE
TIKKSAALLKKELNAEDGVEPRYWKLSKYEVNVPRSGQPELTSAGVYERDSETGEFRDEDIAKILKDSTYEVAGTFGARHIPAAMRWIECQGMRTSRDVWKTCTLNEFRAFLGLKEFESF
EEWNSDPSVASAMQDLVGHPANIPLHVGLHGEEAKKPRLGAGLCPNYTNSRAILSDAVSLVRGDRFYTDSATADTMTDWGLRDCQPDVQEGAYGGMLQKLIRNNLPDQYVFNDVALLFPF
KTPQSSYSILEKIGPQKALQYSLQPTPTPHLSLGYKHIQSGGKTMVYEISDTPKVEVERMSLLFGLPKMNSNIKLIYQAVEMAMSRQNSEQYKLFIQSRIQQCSARRSPVSTDETVDVAR
DVTNPLICGWLSHIFGLVETGIHSQQLLLCALSDIYCYLNAHDQISFKSRASARVAASGFAWQIKQHIEASSPPNSIGNLIRRGVSKLTIGAIDVLEDSIKTISGQRPDIKHTSPDTKIF
YDTIRVENDAQRIPLSIDELTADCLRAVSTLAYTIVNGTAHALDYLMPATTTHADEIPKLRQTLHDLVHNPRFDRSNIHEAHLKHGLEGVRLAHWNPYLRAISFGVKLEHRAHPRPIGII
DREFRLDRNTLEYLRLLDVEGYCLPMFEIILPVIINQVFSLNKVQRAPGMQGRLEKIMITGTSASIPTMHIRYDGSKTLKAINSLRGRRTNGIA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (22 introns) and 6 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACACCCACTAGACCCCCTAGCCGTTATGCTGCCGAACCCAAACCAGGTGAAGCTCTTCTGCAGAGTGCAGGGTACACTCATCTGTTACTTGTTGGTCAAGCAAAAGACTTGCCG
ACGTTGAGCGCTTCGCCTGTCTGGCGCAAAGCCTCTCAATTGCAGGAG
AGGTGAGTTCTTCTCATATTTCTCCCCGTTGGTGTATGTTCGTTTTTTGATGTTTCCTCTGTCTTAGACCAT
TGGCTCCGTGTCACATTACCTGTTCTCCAGAGGTAGCTCAAATAGTGGTCTCAACAATGAAGACGAGGTGGCGCTCACCGACAGCAAAACTCCAACTTCGCTCATATTCCTCAGTGTCCA
ACAACTTTTGTCTGGTAGAATTCCTGAAAACCTTTCCATGATAATAAACATTTTGTCTAGTGTAGGTAAACCTCTAGATGATAGAAAGATGCAACTGGAAGATGTTGTGGGTTGGTTAGC
CACGTCTGGTAGAAAAAACCAACATGCACCCAACAAGATGGTGAATGACGTCCAAGGTCAATTCATAGATATACTCTGGAAT
ATGTAAGTCCTTTCAAGTCTCTATAACACAAGTTCCCT
TTGCACGATTGAAATGTTAATCACCTCACTTTCACTGCTTCTTTTGCCTAAAGGACCTCTCGCATCCATCAACTGTTGATCTGAATCCCAAACATCGCTTTAGAACGCCCGATGGTCGGA
ACAACAATATCATTGGTTCCCCATTTCTTGGTGCTGCCAATCAACCCTATGCTAGATCTGTCAAGGCACTTCACCCTCGCGCACCTTACGTCGCGGAGCCGGAAGAGATGTTCGATTCTA
TCCTGCGTCGTCCCGAGGGTTTTGAAGGTTTTGTTCCTCATCCTGCTGGAATATCAAGTCTCTTGTTCGGCTTTGCCAACATCATCATCCATGATATCT
CTGTGAGATTGATCTACTTTA
CTTCATCAACCTGATTGTTAGTGACTGATTTCGAAATTCACACTTGAACCATAGTCTGGACTAACACTGGTCCAGAAGTTAAAGGTCCGGGATCCGATACCGATTCGAATCAATACGGTG
ACAGCGGGAATGGATCCTCGCGTGCAAGCCAATGGCAAAATTTGACATCCTCTTATCTTTCCTTGGATCCTTTATACGGAGTCGGACAAGAGGAACAAGACAAGATTCGCAACAAAGAGG
ACCTTGGCCGCGGCTTGTTGTACAATGACACTTTTGCATCCAGTCGATTACTTGTGATGCCTCCAGCATCGTGTGCTCTACTTGTAATCTTTTCTAGAAACC
CCGTAAGTGTTTATTTGT
GAATCTATTGAACGAATTACAAAAGCCTTTCGCTGAAAGATATCCACATTCAATCAATCAGATAATCGAGTTGCTAAAAGGCTTCTGGAGATCAATGAACGCAAAACTTGGACAGCCGAT
TTGGAGAAACTCAGTCCCGAGCAATTGCAGCAACAAGACGATGAGATTTTTGGCACCGCCAGATTGATCAATTGCGGCTATTATGTAGAGATGATTCTCCACGACTATCTCAGC
GCGTAA
GTTTATCAATCGAGCCGATGAACTGTTCTCCTGCCGGTTTTCAAACATATCGCTTTGAGTTTTTGTTGAACGTACTTTCTTCCCAATCGTCAGGCTATCTTAAACACTACACAAGCCGAC
AGTGACTGGGCGCTCGACCCTAGAGCTCCGATCAAAAGTATCCTCGGGAGTACCCCTAAGGCTACTGGAAACTCAGTCACAGTTGAATTCAATTCTCTAT
ATGTAAGCATCCTCCTTATC
TTGTTTTGTGATCAATCAGTTATGCCCAATAGTCATTTATCTGAGCATTGACTGCCATGATAGATCGCTGGCACGCTCCGATGTCGTGGTCCCAAAGTGTGTGAGTTCGGTTATAGTCAC
TCATGTCTGTACATATCATGACTTACATGTATATGACTTAGAAATGGATCGAGAGAGTATGTTTGAACGGGCTCTTCCTAGTAGAAGTAAGATATCTTTTCCCATTTCTTTCCAATTCGA
TTAAATTTGACTATGACCCCTTTCAGAATGGGAGGACGTGAATCATGAGACCATCAAAAAATCAGCCGCCTTATTGAAGAAGGAGCTTAATGCTGAAGACGGGGTAGAGCCTAGATATTG
GAAG
AGGTTAGTTTATCTTTTTGTGTGTCTCTATTGTGTGTAACTCTTCGCAAAGTCACTTATCTCCCACTTATCGACCTTGGAATTGCGCAGTTATCTAAATACGAAGTCAACGTTCCT
AGAAGTGGCCAACCAGAGCTGACCTCCGCAGGAGTTTACGAAAGGGACTCAGAGACCGGTGAATTCCGTGATGAGGACATTGCAAAGATTTTGAAAGATTCTACGTACGAAGTTGCTGGT
ACTTTCGGAGCACGCCATATACCTGCAGCCATGAGATGGATTGAATGTCAAGGAATGCGAACTTCTAG
AGGTACGTCAAGGTATTTTGAAGAGTAAAACATGGTCTTTAGACATTATCTC
ATCATCTTTTTGTTTCACTTGTGGTTGTGGGTGACTGGATTAACAGAGATGTGTGGAAAACCTGCACCCTGAATGAATTCAGAGCTTTTCTGGGTTTGAAGGAATTTGAATCATTTGAGG
AATGGAATTCGGATCCTTCTGTG
TGGTAAGCTCCTACTCAACCTCATCAATCCCCTAAATCCCACGGTAGCCCCTTCAATCTGACTTCAAACATCTCTTGTTGGTTTCACCAGGCTTCTG
CTATGCAGGATCTTGTCGGCCATCCTGCGAACATTCCATTACATGTTGGTTTGCATGGTGAGGAAGCTAAGAAGCCAAGATTAGGAGCAGGGTTGTGTCCAAATTACACAAACAGTCGGG
CTATCTTGAGTGATGCAG
AGGTTGGCCACTTTCACACACTCCGTGACCATGAAAGATTGTCGACCACTTGTTAATTTCTCTTTGACGTCCATAGTTTCCCTTGTTCGGGGAGATCGGTTC
TACACG
CGGTGAGTATCTCAAAGCGCCTATCTTCGAACCAGTTTGATCCTAGAGACTCGCTGACAAGTGTCATTTCTTAGGACTCTGCAACTGCCGACACTATGACGGATTGGGGCCTGC
GTGACTGTCAACCGGACGTTCAAGAAGGGGCTTACGGTGGCATGTTGCAAAAATTGATACGCAATAACTT
TTGTAAGTATCTTCTGTAGTGTCTGTAGTTGGTGGCAAATCATCTCATCT
TGTTCCACTTTTTCACTCGCAGGCCGGATCAATATGTATTCAACGACGTTGCTCTACTATATGTGCGTCCAATATCACCCCCTGAGGCTGTTTATTGAATTGCTTATCAGCTTCTTTGCT
ACACATACAGTTCCTTTCAAAACCCCTCAAAGTTCCTACTCGATTCTGGAGAAAATAGGCCCTCAAAAGGCCCTGCAATATTCGCTTCAACCTACTCCTACTCCACATTTGTCCCTAGGT
TACAAACACATACAATCGGGCGGAAAAACAATGGTCTATGAGATTTCTG
TGGTATGCTTACTTCTTACCGGAATCTTTTTCAGAATTCTGACCAGTTTAATTTGTATCAGACACTCCGAA
AGTCGAAGTAGAAAGAATGAGCTTGCTTTTTGGTTTG
TGGTCAGTTTTCTAAATCGGGTTGTCCTTCGAAGTAGCCTCTTCTGATCATTCTGTGATTCTACAGCCAAAGATGAATTCAAA
CATCAAGCTTATTTACCAGGCAGTTGAGATGGCGATGTCCAGACAAAACTCCGAACAGTACAAGTTGTTCATTCAAAGTCGCATCCAACAATGTTCGGCCAGACGAAGCCCAGTGTCTAC
CGATGAGACTGTCGATGTAGCGCGGGACGTGACCAACCCATTGATATGTGGATG
TGGTAAGCTTAAACTTTCAACAGAAAGAGAAATGCAAAATGCAAGATCTGACATTCACAATCACGA
ATTTCCATTCAAGGCTTTCTCATATCTTTGGACTTGTGGAAACTGGGATTCACTCGCAGCAGCTTCTCCTCTGCGCATTAAGCGACATATGTAAGTTTTCTATACAACGAGCCGAACAAT
TTCTCGAGTATCATTTGACGATGTTCTCTTTCAGCTATTGCTATCTGAATGCACATGACCAAATCTCCTTCAAATCCAGAGCTTCTGCTCGTGTCGCCGCTTCGGGTTTTGCTTGGCAAA
TCAAACAACATATTGAGGCATCTTCACCTCCCAAT
ATGTAAGAGAAAAATCTTGGTCTCTTCTCCGGTTGAATCAACTCTGATCATGCCTTCGTTCATCTTTAGTCGATCGGAAATTTGA
TCAGAAGAGGAGTTTCTAAGCTCACCATAGGTGCAATCGATGTCCTCGAGGATTCCATCAAGACCATATCTGGTCAAAGACCGGATATCAAGCATACTTCTCCTGACACCAAGATCTTCT
ATGATACCATAAGAGTAGAGAATGATGCTCAAAGAATCCCACTTTCTATTGACGAGCTCACAGCCGATTGCTTGCGAGCCGTCTCAACCTTGGCATACACTATTGTCAACGGTACAGCGC
ATGCGTTAGACTATCTGATGCCCGCTACAACGACCCACGCAGATGAGATTCCTAAACTTCGACAAACGTTACACGACTTGGTCCACAACCCCCGCTTCGACCGATCGAACATACATGAGG
CTCATCTAAAGCATGGGTTGGAAGGTGTGCGATTGGCCCATTGGAATCCTTACCTGCGAGCTATATCGTTTGGCGTAAAACTTGAACACAGGGCCCATCCT
CTGTAAGCACGACCTGATT
TTTCTTTATTCACGTAATTAGAAGCATTGACACGACAACTCCTCAGCGTCCGATCGGCATCATCGACCGTGAATTTCGACTCGACCGAAACACTTTGGAATACTTGCGATTATTAGATGT
GGTGCGCTCGCTCTCTTGATGTTTATTTATATAGCGCTGACTCCAAAATCCCCGTCTTTTTCCCACTTTATTGGGCTATAGTCGAGGGCTATTGCCTCCCTATGTTTGAGATTATTCTGC
CCGTCATCATCAATCAAGTTTTCTCTCTTAACAAGGTCCAGCGTGCACCAGGTATGCAGGGTAGGTTGGAGAAGATCATGATCACGGGTACCTCCGCGTCCATACCGACCATGCACATTA
GATACGATGGGTCCAAAACCTTGAAGGCGATAAACAGCCTCCGAGGCAGAAGAACAAATGGTATTGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCACACCCACTAGACCCCCTAGCCGTTATGCTGCCGAACCCAAACCAGGTGAAGCTCTTCTGCAGAGTGCAGGGTACACTCATCTGTTACTTGTTGGTCAAGCAAAAGACTTGCCG
ACGTTGAGCGCTTCGCCTGTCTGGCGCAAAGCCTCTCAATTGCAGGAG
ACCATTGGCTCCGTGTCACATTACCTGTTCTCCAGAGGTAGCTCAAATAGTGGTCTCAACAATGAAGACGAG
GTGGCGCTCACCGACAGCAAAACTCCAACTTCGCTCATATTCCTCAGTGTCCAACAACTTTTGTCTGGTAGAATTCCTGAAAACCTTTCCATGATAATAAACATTTTGTCTAGTGTAGGT
AAACCTCTAGATGATAGAAAGATGCAACTGGAAGATGTTGTGGGTTGGTTAGCCACGTCTGGTAGAAAAAACCAACATGCACCCAACAAGATGGTGAATGACGTCCAAGGTCAATTCATA
GATATACTCTGGAAT
GACCTCTCGCATCCATCAACTGTTGATCTGAATCCCAAACATCGCTTTAGAACGCCCGATGGTCGGAACAACAATATCATTGGTTCCCCATTTCTTGGTGCTGCC
AATCAACCCTATGCTAGATCTGTCAAGGCACTTCACCCTCGCGCACCTTACGTCGCGGAGCCGGAAGAGATGTTCGATTCTATCCTGCGTCGTCCCGAGGGTTTTGAAGGTTTTGTTCCT
CATCCTGCTGGAATATCAAGTCTCTTGTTCGGCTTTGCCAACATCATCATCCATGATATCT
TCTGGACTAACACTGGTCCAGAAGTTAAAGGTCCGGGATCCGATACCGATTCGAATCAA
TACGGTGACAGCGGGAATGGATCCTCGCGTGCAAGCCAATGGCAAAATTTGACATCCTCTTATCTTTCCTTGGATCCTTTATACGGAGTCGGACAAGAGGAACAAGACAAGATTCGCAAC
AAAGAGGACCTTGGCCGCGGCTTGTTGTACAATGACACTTTTGCATCCAGTCGATTACTTGTGATGCCTCCAGCATCGTGTGCTCTACTTGTAATCTTTTCTAGAAACC
ATAATCGAGTT
GCTAAAAGGCTTCTGGAGATCAATGAACGCAAAACTTGGACAGCCGATTTGGAGAAACTCAGTCCCGAGCAATTGCAGCAACAAGACGATGAGATTTTTGGCACCGCCAGATTGATCAAT
TGCGGCTATTATGTAGAGATGATTCTCCACGACTATCTCAGC
GCTATCTTAAACACTACACAAGCCGACAGTGACTGGGCGCTCGACCCTAGAGCTCCGATCAAAAGTATCCTCGGGAGT
ACCCCTAAGGCTACTGGAAACTCAGTCACAGTTGAATTCAATTCTCTAT
ATCGCTGGCACGCTCCGATGTCGTGGTCCCAAAGTAAATGGATCGAGAAATGGGAGGACGTGAATCATGAG
ACCATCAAAAAATCAGCCGCCTTATTGAAGAAGGAGCTTAATGCTGAAGACGGGGTAGAGCCTAGATATTGGAAG
TTATCTAAATACGAAGTCAACGTTCCTAGAAGTGGCCAACCAGAG
CTGACCTCCGCAGGAGTTTACGAAAGGGACTCAGAGACCGGTGAATTCCGTGATGAGGACATTGCAAAGATTTTGAAAGATTCTACGTACGAAGTTGCTGGTACTTTCGGAGCACGCCAT
ATACCTGCAGCCATGAGATGGATTGAATGTCAAGGAATGCGAACTTCTAG
AGATGTGTGGAAAACCTGCACCCTGAATGAATTCAGAGCTTTTCTGGGTTTGAAGGAATTTGAATCATTT
GAGGAATGGAATTCGGATCCTTCTGTG
GCTTCTGCTATGCAGGATCTTGTCGGCCATCCTGCGAACATTCCATTACATGTTGGTTTGCATGGTGAGGAAGCTAAGAAGCCAAGATTAGGA
GCAGGGTTGTGTCCAAATTACACAAACAGTCGGGCTATCTTGAGTGATGCAG
TTTCCCTTGTTCGGGGAGATCGGTTCTACACGGACTCTGCAACTGCCGACACTATGACGGATTGGGGC
CTGCGTGACTGTCAACCGGACGTTCAAGAAGGGGCTTACGGTGGCATGTTGCAAAAATTGATACGCAATAACTT
GCCGGATCAATATGTATTCAACGACGTTGCTCTACTATTTCCTTTC
AAAACCCCTCAAAGTTCCTACTCGATTCTGGAGAAAATAGGCCCTCAAAAGGCCCTGCAATATTCGCTTCAACCTACTCCTACTCCACATTTGTCCCTAGGTTACAAACACATACAATCG
GGCGGAAAAACAATGGTCTATGAGATTTCTG
ACACTCCGAAAGTCGAAGTAGAAAGAATGAGCTTGCTTTTTGGTTTGCCAAAGATGAATTCAAACATCAAGCTTATTTACCAGGCAGTT
GAGATGGCGATGTCCAGACAAAACTCCGAACAGTACAAGTTGTTCATTCAAAGTCGCATCCAACAATGTTCGGCCAGACGAAGCCCAGTGTCTACCGATGAGACTGTCGATGTAGCGCGG
GACGTGACCAACCCATTGATATGTGGATG
GCTTTCTCATATCTTTGGACTTGTGGAAACTGGGATTCACTCGCAGCAGCTTCTCCTCTGCGCATTAAGCGACATCTATTGCTATCTGAAT
GCACATGACCAAATCTCCTTCAAATCCAGAGCTTCTGCTCGTGTCGCCGCTTCGGGTTTTGCTTGGCAAATCAAACAACATATTGAGGCATCTTCACCTCCCAAT
TCGATCGGAAATTTG
ATCAGAAGAGGAGTTTCTAAGCTCACCATAGGTGCAATCGATGTCCTCGAGGATTCCATCAAGACCATATCTGGTCAAAGACCGGATATCAAGCATACTTCTCCTGACACCAAGATCTTC
TATGATACCATAAGAGTAGAGAATGATGCTCAAAGAATCCCACTTTCTATTGACGAGCTCACAGCCGATTGCTTGCGAGCCGTCTCAACCTTGGCATACACTATTGTCAACGGTACAGCG
CATGCGTTAGACTATCTGATGCCCGCTACAACGACCCACGCAGATGAGATTCCTAAACTTCGACAAACGTTACACGACTTGGTCCACAACCCCCGCTTCGACCGATCGAACATACATGAG
GCTCATCTAAAGCATGGGTTGGAAGGTGTGCGATTGGCCCATTGGAATCCTTACCTGCGAGCTATATCGTTTGGCGTAAAACTTGAACACAGGGCCCATCCT
CGTCCGATCGGCATCATC
GACCGTGAATTTCGACTCGACCGAAACACTTTGGAATACTTGCGATTATTAGATG
TCGAGGGCTATTGCCTCCCTATGTTTGAGATTATTCTGCCCGTCATCATCAATCAAGTTTTCTCT
CTTAACAAGGTCCAGCGTGCACCAGGTATGCAGGGTAGGTTGGAGAAGATCATGATCACGGGTACCTCCGCGTCCATACCGACCATGCACATTAGATACGATGGGTCCAAAACCTTGAAG
GCGATAAACAGCCTCCGAGGCAGAAGAACAAATGGTATTGCGTGA

Retrieve as FASTA