Entry information : Sre1CysPrx
Entry ID 10668
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-02 (Christophe Dunand)
Peroxidase information: Sre1CysPrx
Name Sre1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Sporisorium
Organism Sporisorium reilianum    [TaxId: 72558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sre1CysPrx
start..stop
S start..stop
Um1CysPrx 439 8.43e-160 1..221 1..221
Gin1CysPrx01 328 8.36e-116 4..216 3..215
Tcam1CysPrx 318 8.31e-112 1..201 1..206
Gve1CysPrx 313 4.31e-110 4..214 1..211
Gene structure Fichier Exons


exon

Literature and cross-references Sre1CysPrx
Protein ref. UniProtKB:   E6ZWI2
Protein sequence: Sre1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24516.66 Transmb domain:   %s   i7-24o
PI (pH):   %s   5.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLRLGSIAPNFTAETTHGVLNFHEYLGDSWGILFSHPDDFTPVCTTELGEVARKEPEFKKRGVKVIGLSANDIASHDAWIKDINEVGKTSVNFPIIGDKDRKVSTEYDMLDALDPTNV
DAKGIPFTVRDVFVIDPKKVIRLKISYPASTGRHFDEILRVIDSLQIGDKYRVTTPVNWQKGDKVIVHPSVQGEEAEKLFPGYETVTPYLRFTKDPSATSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 23, 1 intron).
DNA
Send to BLAST
CDS
Send to BLAST