Entry information : OsPrx57(LOC_Os04g55740)
Entry ID 1067
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx57(LOC_Os04g55740)
Name OsPrx57(LOC_Os04g55740)
Class Class III peroxidase    [Orthogroup: Prx177]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx57
start..stop
S start..stop
ZmPrx91 547 0 4..319 3..321
SbPrx95 541 0 1..319 1..321
SiPrx55 527 0 22..319 21..320
BdiPrx133 499 2e-180 25..319 28..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33215006..33215218 213 N° 2 33214487..33214678 192 N° 3 33213852..33214406 555  
complement(join(33213852..33214406,33214487..33214678,33215006..33215218))


exon

Literature and cross-references OsPrx57(LOC_Os04g55740)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q7XMP4
DNA ref. GenBank:   NC_008397.1 (33215218..33213855)
Protein sequence: OsPrx57(LOC_Os04g55740)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (295)
PWM (Da):   %s   33762.42 (31245.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   4.44 (4.39) Peptide Signal:   %s   cut: 25 range:25-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYSRQIFVCSAMAALLFSAVVSAQLSTDFYDETCPDALDIIESAVRDAVSKESRMGASLLRLHFHDCFVNGCDGSVLLDDTAAITGEKNAKPNKNSLRGFEVVDDIKSQLEDACEQVVSCADILAVAARDSVVALGGPTWDVELGRRDGTTASLDAANNDLPPPTSDLADLIKSFSDKGLTASDMIALSGAHTIGQARCTNFRGRLYNETNLDATLATSLKPSCPNPTGGDDNTAPLDPATSYVFDNFYYRNLLRNKGLLHSDQQLFSGGSADAQTTAYATDMAGFFDDFRGAMVKMGGIGVVTGSGGQVRVNCRKVN*

Retrieve as FASTA  
Remarks chromosome 4. No ESTs. TC259589
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATTCCAGGCAAATCTTCGTCTGCTCTGCCATGGCTGCGTTGCTCTTCTCTGCTGTTGTTTCGGCGCAGCTCTCCACTGATTTCTACGACGAGACATGCCCCGACGCGCTCGAC
ATCATCGAATCTGCCGTCAGAGACGCCGTTTCCAAGGAGTCTCGCATGGGAGCTTCGCTGCTGCGCCTCCATTTCCACGACTGCTTTGTCAAT
GCAAGTCTCACACAACTCACCCTTTTA
AGTTCAGTTTTCCTTCTCGTTTTCTAGTCCGACCTTTGAAGTAGATGTTTCAATTTCGAAATTCGCTAGTCGCTACAGTTTACTTACTTAGTTACTAGTCGCCAAACATTTTATATTCAG
ATGATTTTTCCCGTGTTCATAAATCATAATAGATATAATTCAGAAGTTCAGAGTGGATGCTGACGGGTCAGTTAAGCAAGTGGTGTGCATGCAGAAAGCGCGCGAAAAGTCTACTTAAAA
GTTAACCTTTTCAAATTCGAAGGACTAACCATTGACCTCAAAAACGGCGCGCGCGTGCAGGGGTGTGACGGGTCAGTGCTGCTCGACGACACGGCGGCCATCACCGGCGAGAAGAACGCG
AAGCCGAACAAGAACTCCCTCCGCGGCTTCGAGGTCGTCGACGACATCAAGTCGCAGCTCGAGGACGCCTGCGAGCAGGTCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGAC
TCCGTCGTCGCC
GTAAGCACCAGACCGGCCGATCACCACTCCGATCCCTGTATTTTTGATGAATTGATCGGGAACGAACGAACTGTGTGCAGCTGGGCGGGCCGACGTGGGACGTCGAGC
TGGGCCGGCGAGACGGGACGACGGCGAGCCTGGACGCGGCGAACAACGACCTCCCGCCGCCGACGTCCGACCTCGCCGACCTGATCAAGTCCTTCTCCGACAAGGGCCTGACGGCGAGCG
ACATGATCGCGCTGTCGGGCGCGCACACCATCGGGCAAGCCAGGTGCACCAACTTTCGCGGCCGCCTCTACAACGAGACCAACCTCGACGCCACCCTCGCCACCTCGCTGAAGCCGAGTT
GCCCCAACCCCACCGGCGGCGACGACAACACGGCGCCGCTCGACCCGGCCACCTCCTACGTGTTCGACAACTTCTACTACAGGAACCTCCTGAGGAACAAGGGCCTTCTGCACTCGGACC
AGCAGCTGTTCAGCGGCGGCTCCGCCGACGCGCAGACCACCGCCTACGCCACCGACATGGCCGGCTTCTTCGACGACTTCCGTGGCGCCATGGTGAAGATGGGCGGCATCGGCGTCGTCA
CCGGCTCCGGTGGCCAGGTCAGGGTTAACTGCAGGAAGGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATTCCAGGCAAATCTTCGTCTGCTCTGCCATGGCTGCGTTGCTCTTCTCTGCTGTTGTTTCGGCGCAGCTCTCCACTGATTTCTACGACGAGACATGCCCCGACGCGCTCGAC
ATCATCGAATCTGCCGTCAGAGACGCCGTTTCCAAGGAGTCTCGCATGGGAGCTTCGCTGCTGCGCCTCCATTTCCACGACTGCTTTGTCAAT
GGGTGTGACGGGTCAGTGCTGCTCGAC
GACACGGCGGCCATCACCGGCGAGAAGAACGCGAAGCCGAACAAGAACTCCCTCCGCGGCTTCGAGGTCGTCGACGACATCAAGTCGCAGCTCGAGGACGCCTGCGAGCAGGTCGTCTCC
TGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCGCC
CTGGGCGGGCCGACGTGGGACGTCGAGCTGGGCCGGCGAGACGGGACGACGGCGAGCCTGGACGCGGCGAACAAC
GACCTCCCGCCGCCGACGTCCGACCTCGCCGACCTGATCAAGTCCTTCTCCGACAAGGGCCTGACGGCGAGCGACATGATCGCGCTGTCGGGCGCGCACACCATCGGGCAAGCCAGGTGC
ACCAACTTTCGCGGCCGCCTCTACAACGAGACCAACCTCGACGCCACCCTCGCCACCTCGCTGAAGCCGAGTTGCCCCAACCCCACCGGCGGCGACGACAACACGGCGCCGCTCGACCCG
GCCACCTCCTACGTGTTCGACAACTTCTACTACAGGAACCTCCTGAGGAACAAGGGCCTTCTGCACTCGGACCAGCAGCTGTTCAGCGGCGGCTCCGCCGACGCGCAGACCACCGCCTAC
GCCACCGACATGGCCGGCTTCTTCGACGACTTCCGTGGCGCCATGGTGAAGATGGGCGGCATCGGCGTCGTCACCGGCTCCGGTGGCCAGGTCAGGGTTAACTGCAGGAAGGTCAATTAA

Retrieve as FASTA