Entry information : SrePrxII
Entry ID 10670
Creation 2012-03-02 (Christophe Dunand)
Last sequence changes 2012-03-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-02 (Christophe Dunand)
Peroxidase information: SrePrxII
Name SrePrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Sporisorium
Organism Sporisorium reilianum    [TaxId: 72558 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SrePrxII
start..stop
S start..stop
UmPrxII 335 2.32e-120 1..171 1..171
AthiPrxII 190 7.61e-63 3..171 6..172
SlutPrxII01 188 6.01e-62 1..171 4..172
SbrePrxII01 187 1.11e-61 1..171 4..172
Gene structure Fichier Exons


exon

Literature and cross-references SrePrxII
Protein ref. UniProtKB:   E7A1I8
DNA ref. GenBank:   FQ311472.1 (412052..411205)
Protein sequence: SrePrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18076.22 Transmb domain:   %s   i5-22o
PI (pH):   %s   5.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAISKGEQIPNATFMYVPWAPELADGTACGAPTKVQTHEAFKGKKVVIVAVPGAYTPTCHVNHIPPYIKQVDAFKAKGVDQIVVLAQNDPFVMSAWGVQNKAEDKVIFATDLNLEFSKGI
GSTADLSAMGFGERTGRYALIVDDLKVVDFSAEPNPGAVEVSGADHVLAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 2 introns)
DNA
Send to BLAST
CDS
Send to BLAST