Entry information : DpriCcP (CCP1)
Entry ID 10676
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: DpriCcP (CCP1)
Name (synonym) DpriCcP (CCP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Dacryopinax primogenitus    [TaxId: 1858805 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DpriCcP
start..stop
S start..stop
SnivCcP01 505 0 6..376 4..368
SsteCcP01 502 1.14e-179 2..375 1..371
AdelCcP01 491 3.68e-175 13..376 25..386
ScomCcP 489 2.61e-174 9..376 7..378
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10676' 'complement(join(579020..579122,579179..579262,579316..579462,579520..579602,579656..579926,579978..580059,580109..580463))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 580109..580463 353 N° 2 579978..580059 80 N° 3 579656..579926 269 N° 4 579520..579602 81
N° 5 579316..579462 145 N° 6 579179..579262 82 N° 7 579020..579122 101  
complement(join(579020..579122,579179..579262,579316..579462,579520..579602,5796 56..579926,579978..580059,580109..580463))


exon

Literature and cross-references DpriCcP (CCP1)
DNA ref. JGI genome:   scaffold_4 (580463..579020)
Cluster/Prediction ref. JGI gene:   20779
Protein sequence: DpriCcP (CCP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   375
PWM (Da):   %s   41668.63  
PI (pH):   %s   8.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFASVLRTQLRRPLVGAAGRMPAVAPVTRNVIRARGYATEAGGSSNTLLWVLGAAAAAGGGYWYYAAGSTDVMKKEAESAVKSASQAVKAATKFTPTKDDYQKVYNDIAELLDDNDYDDG
SYGPVLVRLAWHSSGTYDKNDNTGGSNYATMRFPSEAGHGANAGLEVARTKIEEIKQKYPWMSYGDLWTLGGVCAVQEMQGPKIPWRPGRIDGFAKDATPDGRLPDASKAADHLRNIFYR
MGFDDQAIVALSGAHALGRCHRNRSGFDGPWTFSPTTFTNDYFTLLMNERWTWRKWDGPKQLQDKTKTLMMLPSDFALVQDREFKKWVKVYAGDNDKFFSDFSKYFSELLELGVPRAQFV
ASEPWIMKTIDEQSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGCCAGCGTCCTTCGCACCCAACTTCGTCGCCCCCTCGTGGGCGCCGCTGGCCGTATGCCAGCGGTCGCCCCTGTTACTCGTAACGTGATCCGTGCGCGGGGGTATGCTACCGAA
GCTGGTGGCAGCAGCAACACGCTCTTGTGGGTGCTCGGAGCCGCCGCCGCCGCCGGAGGTGGGTACTGGTACTACGCTGCTGGCTCCACCGACGTTATGAAGAAGGAGGCCGAGAGTGCC
GTCAAGTCTGCAAGCCAGGCTGTCAAGGCTGCGACCAAGTTCACCCCCACCAAGGATGACTACCAGAAGGTGTACAACGACATTGCCGAGCTCCTTGACGATAACGACTACGATG
GTGAG
TGGGTATAGTTCCATATATGGAAAGTTATTCATTGACGTTGCAGATATGGCTCTTACGGACCTGTTCTTGTTCGTCTTGCCTGGCACTCCTCGGGCACTTACGATAAGAATGACAACACT
GGCGGCAG
GTGAGCCCGACGCGTTATGAGAGTTTAAAGTATTTCTCACCATTCGTATAGCACAACTACGCGACCATGCGTTTCCCCTCTGAAGCTGGTCATGGCGCGAATGCCGGTCTCG
AAGTCGCTCGTACCAAAATTGAGGAAATCAAGCAGAAGTATCCTTGGATGTCCTACGGCGATCTCTGGACTCTCGGCGGTGTTTGCGCTGTTCAGGAAATGCAAGGCCCAAAGATTCCCT
GGAGGCCTGGCCGTATCGACGGCTTTGCGAAGGATGCTACTCCCGACGGTCGCCTTCCCGACGCCTCCAAGGCGGCTGATCATCTCCGGAAC
GTAAGCAGAGAGTCCATTTCGTGCGTTA
TCCCAGTGCTCACATAGCATTGTAGATATCTTCTACCGCATGGGTTTTGACGACCAGGCTATCGTTGCTCTGTCCGGTGCCCACGCCCTCGGCCGCTGCCACCGTAACCGGTGAGGATCT
CTTCTTAATGTTCTCGTTTGACTCTTTGGGCTGATGAGTATCGTCAGATATCTGGGTTCGATGGTCCCTGGACCTTCTCGCCTACTACTTTCACCAACGACTACTTCACTCTCTTGATGA
ACGAGAGGTGGACTTGGCGCAAGTGGGATGGACCTAAGCAGCTCCAGGACAAGACGAAGACCCTTATGATGCTTCC
GTATGCGTCGTCACGTGGCTGAGAGTCACCCCAGACTGACCCAT
CATACACAGTTTTCGGACTTTGCTCTCGTACAAGACAGGGAGTTCAAGAAATGGGTCAAGGTGTACGCTGGCGACAACGACAAGTTCTTCTCCGAGTGCGTGACTCTGACTACATGAGCG
CTTTGACCCGACTGACAGGAATTTTCACAAGCTCTTCTCCAAATACTTCTCCGAGCTCCTGGAACTCGGTGTTCCCCGTGCTCAGTTTGTTGCAAGCGAGCCTTGGATTATGAAGACGAT
CGATGAACAGAGTTCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTGCCAGCGTCCTTCGCACCCAACTTCGTCGCCCCCTCGTGGGCGCCGCTGGCCGTATGCCAGCGGTCGCCCCTGTTACTCGTAACGTGATCCGTGCGCGGGGGTATGCTACCGAA
GCTGGTGGCAGCAGCAACACGCTCTTGTGGGTGCTCGGAGCCGCCGCCGCCGCCGGAGGTGGGTACTGGTACTACGCTGCTGGCTCCACCGACGTTATGAAGAAGGAGGCCGAGAGTGCC
GTCAAGTCTGCAAGCCAGGCTGTCAAGGCTGCGACCAAGTTCACCCCCACCAAGGATGACTACCAGAAGGTGTACAACGACATTGCCGAGCTCCTTGACGATAACGACTACGATG
ATGGC
TCTTACGGACCTGTTCTTGTTCGTCTTGCCTGGCACTCCTCGGGCACTTACGATAAGAATGACAACACTGGCGGCAG
CAACTACGCGACCATGCGTTTCCCCTCTGAAGCTGGTCATGGC
GCGAATGCCGGTCTCGAAGTCGCTCGTACCAAAATTGAGGAAATCAAGCAGAAGTATCCTTGGATGTCCTACGGCGATCTCTGGACTCTCGGCGGTGTTTGCGCTGTTCAGGAAATGCAA
GGCCCAAAGATTCCCTGGAGGCCTGGCCGTATCGACGGCTTTGCGAAGGATGCTACTCCCGACGGTCGCCTTCCCGACGCCTCCAAGGCGGCTGATCATCTCCGGAAC
ATCTTCTACCGC
ATGGGTTTTGACGACCAGGCTATCGTTGCTCTGTCCGGTGCCCACGCCCTCGGCCGCTGCCACCGTAACCG
ATCTGGGTTCGATGGTCCCTGGACCTTCTCGCCTACTACTTTCACCAAC
GACTACTTCACTCTCTTGATGAACGAGAGGTGGACTTGGCGCAAGTGGGATGGACCTAAGCAGCTCCAGGACAAGACGAAGACCCTTATGATGCTTCC
TTCGGACTTTGCTCTCGTACAA
GACAGGGAGTTCAAGAAATGGGTCAAGGTGTACGCTGGCGACAACGACAAGTTCTTCTCCGA
CTTCTCCAAATACTTCTCCGAGCTCCTGGAACTCGGTGTTCCCCGTGCTCAGTTTGTT
GCAAGCGAGCCTTGGATTATGAAGACGATCGATGAACAGAGTTCG

Retrieve as FASTA