Entry information : ShirCcP (Stehi-CCP)
Entry ID 10687
Creation 2012-03-05 (Christophe Dunand)
Last sequence changes 2012-03-05 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: ShirCcP (Stehi-CCP)
Name (synonym) ShirCcP (Stehi-CCP)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Stereaceae Stereum
Organism Stereum hirsutum    [TaxId: 40492 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ShirCcP
start..stop
S start..stop
HanCcP 569 0 23..375 23..376
LquiCcP01 560 0 1..370 1..369
PcriCcP 556 0 6..372 4..371
SnivCcP01 547 0 1..372 1..367
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1270670..1270963 294 N° 2 1271027..1271075 49 N° 3 1271135..1271216 82 N° 4 1271275..1271428 154
N° 5 1271482..1271598 117 N° 6 1271654..1271736 83 N° 7 1271806..1271883 78 N° 8 1271938..1272093 156
N° 9 1272155..1272269 115  
join(1270670..1270963,1271027..1271075,1271135..1271216,1271275..1271428,1271482 ..1271598,1271654..1271736,1271806..1271883,1271938..1272093,1272155..1272269)


exon

Literature and cross-references ShirCcP (Stehi-CCP)
DNA ref. JGI genome:   scaffold_18 (1270670..1272269)
Cluster/Prediction ref. JGI gene:   134906
Protein sequence: ShirCcP (Stehi-CCP)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   376
PWM (Da):   %s   41457.82  
PI (pH):   %s   7.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQAFAASLRAPARRAAFPAARSIPRANLRQSFRKYSTEPTPPKSSNTTLIFGGLGALAAGGILYTLLSADSAGTTAKSAAQSIKAATKFVPSKEDYQKVYNKIAETLDEADDYDDGSFGPVLLRLAWHSSGTYDKDTKTGGSNYATMRFEPEALHGANAGLNVARGIMEKVKQEFDWISYGDLWTLGGVAAIQEMSGPKIPWRPGRIDGHADNVTPDGRLPDASQGNKHLRDIFYRMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFSPITLTNDYYQLLVSEKWVWRKWGGPAQYADKKTGSLMMLPTDYALVQDKSFKKWVDAYAKDQDLFFKDFSAVLVKLFELGVPESQFVTSDRWEMKTLDEQKEASK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCCTTTGCTGCATCCCTCAGGGCTCCCGCTCGCCGTGCAGCTTTCCCCGCTGCTCGAAGCATTCCCAGGGCAAATCTTCGTCAATCATTCCGCAAGTATTCGACCGAGCCCACC
CCTCCAAAGTCTTCGAACACCACTCTCATCTTCGGTGGTCTTGGTGCCCTCGCCGCCGGTGGTATTCTCTATACCCTTCTCTCCGCTGACTCTGCGGGGACTACCGCCAAGTCGGCTGCT
CAGTCTATTAAGGCCGCCACTAAGTTTGTCCCTTCCAAGGAGGACTACCAAAAG
GCATGTGGTATTGGCGTCCGTATGTAGGTCATATCATTGGCTAACGGTCGCGGAATGGATAAGGTC
TACAACAAAATCGCGGAAACTCTTGACGAGGCTGACGACTACGATG
GTGCGTTCGAAGCCCGCATGTAATTCCTCGACTTTCCAACTCTGACCCGTATGCCTCAGATGGTTCTTTCGGTC
CCGTTCTCCTTCGTCTCGCCTGGCACAGCTCTGGAACATACGACAAGGACACCAAGACCGGCGGAAG
GTATGCTCGTCATATACAACTCTTATATCTTTCCCACCCTCATCCCGTGCGCC
CGTAGCAACTATGCTACCATGCGTTTCGAGCCCGAAGCTCTGCACGGAGCAAACGCTGGCCTTAACGTCGCCCGTGGAATCATGGAGAAGGTCAAACAGGAGTTTGACTGGATAAGCTAC
GGTGACCTTTGGACTCTCGGCGGTGTTGCTGCTATTCAG
GTAGGCTTTCTATCTCCTGTATGTGAACCGTCAGTATTTACCTTCGTCTACAGGAAATGTCTGGCCCCAAGATTCCATGGA
GACCAGGACGTATCGATGGACATGCTGACAATGTGACCCCTGATGGCCGTCTCCCTGATGCGTCTCAAGGCAACAAGCACCTCCGCGAC
GTAGGTGTTTCCAAGCAATATCATTCTATCG
AGTGCCCTAACATTTGTTCTTCAGATATTCTACCGTATGGGCTTCAACGACCAGGAAATCGTCGCTCTCTCTGGTGCTCACGCTCTCGGCCGCTGCCACACTGACCGGTTCGTGGCGTAA
CTTCCGTTCGTAGTCTGCATTCCAGCTTACATGTGTCTCTGTCTCTTCCTGCTTAGTTCCGGCTTCGACGGTCCCTGGACATTCTCTCCCATTACCTTGACTAACGACTACTACCAACTT
CTCGTGAGCGAAAA
GTAAGTTTCCATACCGTTCATCCTTGGTCATTTCTCATCATGTGCTGTCACTAGGTGGGTCTGGAGGAAGTGGGGCGGTCCCGCTCAATACGCCGACAAGAAGACT
GGGTCCTTGATGATGCTTCCTACCGACTATGCTCTCGTCCAGGACAAGTCTTTCAAGAAGTGGGTCGACGCATACGCGAAGGACCAGGATCTCTTCTTCAAGGA
GTAAGTCTTCATTTAT
ACCTGTATGTTTAGGTATAGGCTGACCGGCGTGGCTTTTCCAAAGCTTCTCTGCCGTCCTCGTCAAGCTCTTCGAGCTCGGCGTGCCCGAGTCTCAGTTCGTCACCTCTGACCGTTGGGA
GATGAAGACTCTCGACGAGCAGAAGGAGGCGTCCAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAGGCCTTTGCTGCATCCCTCAGGGCTCCCGCTCGCCGTGCAGCTTTCCCCGCTGCTCGAAGCATTCCCAGGGCAAATCTTCGTCAATCATTCCGCAAGTATTCGACCGAGCCCACC
CCTCCAAAGTCTTCGAACACCACTCTCATCTTCGGTGGTCTTGGTGCCCTCGCCGCCGGTGGTATTCTCTATACCCTTCTCTCCGCTGACTCTGCGGGGACTACCGCCAAGTCGGCTGCT
CAGTCTATTAAGGCCGCCACTAAGTTTGTCCCTTCCAAGGAGGACTACCAAAAG
GTCTACAACAAAATCGCGGAAACTCTTGACGAGGCTGACGACTACGATGATGGTTCTTTCGGTCCC
GTTCTCCTTCGTCTCGCCTGGCACAGCTCTGGAACATACGACAAGGACACCAAGACCGGCGGAAG
CAACTATGCTACCATGCGTTTCGAGCCCGAAGCTCTGCACGGAGCAAACGCTGGC
CTTAACGTCGCCCGTGGAATCATGGAGAAGGTCAAACAGGAGTTTGACTGGATAAGCTACGGTGACCTTTGGACTCTCGGCGGTGTTGCTGCTATTCAG
GAAATGTCTGGCCCCAAGATT
CCATGGAGACCAGGACGTATCGATGGACATGCTGACAATGTGACCCCTGATGGCCGTCTCCCTGATGCGTCTCAAGGCAACAAGCACCTCCGCGAC
ATATTCTACCGTATGGGCTTCAAC
GACCAGGAAATCGTCGCTCTCTCTGGTGCTCACGCTCTCGGCCGCTGCCACACTGACCG
TTCCGGCTTCGACGGTCCCTGGACATTCTCTCCCATTACCTTGACTAACGACTACTACCAA
CTTCTCGTGAGCGAAAA
GTGGGTCTGGAGGAAGTGGGGCGGTCCCGCTCAATACGCCGACAAGAAGACTGGGTCCTTGATGATGCTTCCTACCGACTATGCTCTCGTCCAGGACAAGTCT
TTCAAGAAGTGGGTCGACGCATACGCGAAGGACCAGGATCTCTTCTTCAAGGA
CTTCTCTGCCGTCCTCGTCAAGCTCTTCGAGCTCGGCGTGCCCGAGTCTCAGTTCGTCACCTCTGAC
CGTTGGGAGATGAAGACTCTCGACGAGCAGAAGGAGGCGTCCAAGTAG

Retrieve as FASTA