Entry information : CmPrx94
Entry ID 10690
Creation 2012-03-05 (Qiang Li)
Last sequence changes 2016-04-01 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-01 (Achraf Jemmat)
Peroxidase information: CmPrx94
Name CmPrx94
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Cucurbitaceae Cucumis
Organism Cucumis melo (muskmelon)    [TaxId: 3656 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CmPrx94
start..stop
S start..stop
CsaPrx94 625 0 1..340 1..337
GrPrx02 457 6.38e-163 2..340 1..337
PpePrx77 454 6.85e-162 1..340 2..341
QrobPrx02 447 5.9e-159 27..340 23..335
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10690' 'join(1..261,401..580,699..858,1109..1530)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..261 259 N° 2 401..580 178 N° 3 699..858 158 N° 4 1109..1530 420
join(1..261,401..580,699..858,1109..1530)


exon

Literature and cross-references CmPrx94
DNA ref. GenBank:   NW_007546319.1 (1686506..1684627)
EST ref. GenBank:   JG556630.1 [5' end]
Cluster/Prediction ref. Genebank:   103498963
Protein sequence: CmPrx94
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (311)
PWM (Da):   %s   38104.63 (34886.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.57 (9.31) Peptide Signal:   %s   cut: 30 range:30-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMRERRKCSIVSLVVVGITLMSLCISVRGENTLQSPVKLIWHYYK
LNTTCPNAEEYIKHQVKLFWQKDKSITAKFLRLLSADCLSKN
GCDGSILLDGPNSEKNAPQNKGLGGFEVIDKIKIVLEDRCPGVVSCTDILNLATRDAAHLAGAPSYPVFTGRRDGFTSSIDAVDLPSPSISLQQGIQYFQSKGLDVLDMTTLLGAHSMGK
THCRYIMDRLYNFNGTRKPDPSMHKSLLKDLRKKCPKNSKQDPTVNLTPKSGNDYQFTTLYYSRILSRKAVLGLDQQLLFGDETKEIVEEFADPKTGFEDFRRSFALSMSRMGNIKVLTG
KNGEIRRDCRRRN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. Containing motif 'SADC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGAGAGAGAAGAAAGTGTAGTATTGTATCCCTTGTGGTTGTGGGCATAACATTGATGAGTTTATGCATCAGTGTGAGAGGTGAAAATACATTACAATCACCAGTTAAGCTAATA
TGGCATTACTACAAACTCAACACAACTTGTCCAAATGCTGAGGAATACATAAAACATCAGGTCAAGTTGTTTTGGCAAAAGGATAAAAGCATTACTGCCAAGTTCCTTCGTTTGCTCTCT
GCAGATTGTCTTTCCAAAAAT
ATGTACTATAACTCTTCTTCTTCCATCCCTCTCTCTCTTCTTTTTTTTTTTATTGGATCTAAATCTTTGTTTTTGTAGGATGTTGAGTAGTATTCAAGA
GAGGGTATAGTATTGATGTGTATATTTGATTACTTAATACAGGGTTGTGATGGCTCAATACTTCTTGATGGTCCAAACTCAGAGAAAAATGCACCACAAAACAAAGGCCTCGGAGGGTTT
GAAGTAATTGATAAGATCAAAATTGTACTCGAAGACAGATGCCCGGGTGTTGTTTCTTGTACAGATATTTTGAACTTAGCCACTAGAGATGCTGCCCATTTG
TGGTATTCAAATCTTCTC
GATTCCATTATTATTATCATCAATTTTGTCAGTGTCTATGACTAACGATTGTTGATCGAAACAAATTTCTCAAAATTGACGGTAGATTGGTTGGATATGCAGGCAGGTGCACCATCTTAT
CCTGTTTTTACAGGAAGGAGGGATGGTTTTACAAGCAGTATTGATGCAGTGGATTTACCATCTCCCTCCATATCATTGCAGCAAGGGATTCAATATTTCCAATCTAAGGGTCTCGATGTT
TTGGACATGACAACATTGCTAG
AGGTAACTGACGCATTCTACAAAAATACGTTTAGTTTTGGGGGGAAAAAAAAAGAGTTACCAAATGCAATAACAATAATTTTACGTTTAGTTTAATTT
TTTGTAACTAGTTTACTTAGTTCAAAAGTTTTTATTTTATACTCCTAAAAACACAACAAGATCGCTTCGAAAACCACTTAAAACTTCTCTTATAAATTATATAAATTTTGAGTTCTTTTG
ATAACATTTTATATATATTGTTTAATCAATTCAGGTGCACATTCAATGGGAAAAACACACTGTCGATACATCATGGATAGGCTATACAATTTCAATGGCACCAGAAAGCCAGATCCATCA
ATGCACAAATCACTCTTAAAAGACCTTCGAAAGAAATGCCCAAAGAATTCAAAACAAGACCCAACAGTGAACCTAACACCAAAATCTGGAAACGACTATCAATTCACAACTCTTTACTAC
TCGAGAATCCTCTCCAGAAAGGCGGTACTCGGTCTCGATCAACAGCTTCTTTTCGGTGACGAAACTAAAGAAATCGTCGAGGAGTTTGCTGATCCAAAAACTGGATTTGAAGACTTCCGT
CGGTCCTTTGCTTTGTCCATGAGTAGGATGGGAAACATCAAGGTTTTGACCGGAAAAAATGGCGAGATTCGACGAGATTGTCGGCGAAGAAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGAGAGAGAAGAAAGTGTAGTATTGTATCCCTTGTGGTTGTGGGCATAACATTGATGAGTTTATGCATCAGTGTGAGAGGTGAAAATACATTACAATCACCAGTTAAGCTAATA
TGGCATTACTACAAACTCAACACAACTTGTCCAAATGCTGAGGAATACATAAAACATCAGGTCAAGTTGTTTTGGCAAAAGGATAAAAGCATTACTGCCAAGTTCCTTCGTTTGCTCTCT
GCAGATTGTCTTTCCAAAAAT
GGTTGTGATGGCTCAATACTTCTTGATGGTCCAAACTCAGAGAAAAATGCACCACAAAACAAAGGCCTCGGAGGGTTTGAAGTAATTGATAAGATCAAA
ATTGTACTCGAAGACAGATGCCCGGGTGTTGTTTCTTGTACAGATATTTTGAACTTAGCCACTAGAGATGCTGCCCATTTG
GCAGGTGCACCATCTTATCCTGTTTTTACAGGAAGGAGG
GATGGTTTTACAAGCAGTATTGATGCAGTGGATTTACCATCTCCCTCCATATCATTGCAGCAAGGGATTCAATATTTCCAATCTAAGGGTCTCGATGTTTTGGACATGACAACATTGCTA
G
GTGCACATTCAATGGGAAAAACACACTGTCGATACATCATGGATAGGCTATACAATTTCAATGGCACCAGAAAGCCAGATCCATCAATGCACAAATCACTCTTAAAAGACCTTCGAAAG
AAATGCCCAAAGAATTCAAAACAAGACCCAACAGTGAACCTAACACCAAAATCTGGAAACGACTATCAATTCACAACTCTTTACTACTCGAGAATCCTCTCCAGAAAGGCGGTACTCGGT
CTCGATCAACAGCTTCTTTTCGGTGACGAAACTAAAGAAATCGTCGAGGAGTTTGCTGATCCAAAAACTGGATTTGAAGACTTCCGTCGGTCCTTTGCTTTGTCCATGAGTAGGATGGGA
AACATCAAGGTTTTGACCGGAAAAAATGGCGAGATTCGACGAGATTGTCGGCGAAGAAACTAG

Retrieve as FASTA