Entry information : OsPrx61(LOC_Os04g59190)
Entry ID 1071
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx61(LOC_Os04g59190)
Name OsPrx61(LOC_Os04g59190)
Class Class III peroxidase    [Orthogroup: Prx078]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Pannicles
Roots
Seeds
Shoots
Inducer Abscission
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx61
start..stop
S start..stop
OsPrx64 449 1e-159 12..340 8..338
OsPrx63 440 3e-156 12..335 7..329
OsPrx62 431 3e-152 7..340 6..350
HvPrx03 397 3e-139 1..340 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35243391..35243645 255 N° 2 35242468..35243235 768  
complement(join(35242468..35243235,35243391..35243645))


exon

Literature and cross-references OsPrx61(LOC_Os04g59190)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1N2
DNA ref. GenBank:   NC_008397.1 (35243645..35242471)
Cluster/Prediction ref. UniGene:   Os.7938
Protein sequence: OsPrx61(LOC_Os04g59190)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (305)
PWM (Da):   %s   35134.17 (31977.4) Transmb domain:   %s   i12-34o
PI (pH):   %s   8.21 (7.98) Peptide Signal:   %s   cut: 36 range:36-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATAGRTAGALAVLQLASIVAAAVLLSSPPAAAAEPSVDFIDVVACSQSQVDSIVRSAVQAALQREIALAAGLIRIFFHDCFPQGCDASVYLSGANSEQGMPPNANSLQPRALQLVEDIRAKVHAACGPTVSCTDISALATRAAVVLSGGPTYPVPLGQLDSLAPAPLRLVNQLPGPGTSSVQALIDLFGSRGMGDAADLVALSGGHTVGKSKCAFVRPVDDAFSRKMAANCSANPNTKQDLDVVTPITFDNGYYIALTRKQGVFTSDMALILDPQTAAIVRRFAQDKAAFFTQFVTSIVKLSKVPRPGGNKGEIRRNCFKTNSGARLVDVVEGFAASA*

Retrieve as FASTA  
Remarks chromosome 4. 2 cDNA and 158 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCAACAGCGGGCAGGACCGCGGGCGCATTGGCCGTCCTGCAGCTCGCCTCCATCGTCGCCGCTGCCGTCCTCCTCTCCTCCCCACCTGCGGCTGCTGCTGAGCCGTCTGTGGAC
TTCATTGACGTGGTGGCGTGCTCGCAGTCGCAGGTGGACTCCATCGTGCGCTCAGCCGTGCAGGCGGCGCTCCAGCGTGAGATCGCCCTCGCCGCCGGCCTCATCCGTATCTTCTTCCAC
GACTGCTTCCCGCAG
GCACTTGCTACTATATATACTCTACCTTTTTATGAACTAAACCAACCAACCATCTAATTGAATGAATGTTTAATTCAAGCAAAAACGATCGTGTACGTACTATAC
TAATGGCAAAAGAAGAAAAAAAAGATTAACTGATGATGGAATTAATGCAGGGCTGTGACGCGTCGGTTTACTTGAGTGGCGCCAACTCGGAGCAGGGGATGCCGCCCAACGCCAACTCGC
TGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACATCCGCGCCAAGGTGCACGCCGCATGCGGGCCCACCGTCTCCTGCACCGACATCTCCGCGCTGGCCACCCGCGCGGCCGTCGTCCTCT
CCGGCGGGCCCACCTACCCCGTTCCCCTCGGCCAGCTCGACAGCCTCGCCCCGGCCCCGCTGCGCCTCGTCAACCAGCTCCCGGGCCCGGGCACCTCCAGCGTCCAGGCTCTCATCGACC
TGTTCGGGAGCAGGGGCATGGGAGACGCCGCCGACCTGGTGGCGCTCTCCGGCGGCCACACCGTGGGGAAGTCAAAGTGCGCCTTCGTGAGGCCCGTGGACGACGCCTTCTCCCGGAAGA
TGGCCGCCAACTGCAGCGCCAACCCCAACACGAAGCAGGACCTGGACGTCGTCACCCCCATCACCTTCGACAACGGCTACTACATAGCGCTCACCAGGAAGCAGGGGGTGTTCACCTCCG
ACATGGCGCTCATCCTGGACCCCCAAACTGCGGCCATCGTCAGGCGGTTCGCGCAGGACAAGGCCGCCTTCTTCACGCAGTTCGTTACGTCCATCGTCAAGCTGAGCAAGGTGCCGAGGC
CCGGCGGGAACAAAGGCGAGATCCGCCGCAACTGCTTCAAGACCAACAGCGGAGCACGCCTCGTGGACGTCGTGGAGGGCTTCGCTGCCTCTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCAACAGCGGGCAGGACCGCGGGCGCATTGGCCGTCCTGCAGCTCGCCTCCATCGTCGCCGCTGCCGTCCTCCTCTCCTCCCCACCTGCGGCTGCTGCTGAGCCGTCTGTGGAC
TTCATTGACGTGGTGGCGTGCTCGCAGTCGCAGGTGGACTCCATCGTGCGCTCAGCCGTGCAGGCGGCGCTCCAGCGTGAGATCGCCCTCGCCGCCGGCCTCATCCGTATCTTCTTCCAC
GACTGCTTCCCGCAG
GGCTGTGACGCGTCGGTTTACTTGAGTGGCGCCAACTCGGAGCAGGGGATGCCGCCCAACGCCAACTCGCTGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACATC
CGCGCCAAGGTGCACGCCGCATGCGGGCCCACCGTCTCCTGCACCGACATCTCCGCGCTGGCCACCCGCGCGGCCGTCGTCCTCTCCGGCGGGCCCACCTACCCCGTTCCCCTCGGCCAG
CTCGACAGCCTCGCCCCGGCCCCGCTGCGCCTCGTCAACCAGCTCCCGGGCCCGGGCACCTCCAGCGTCCAGGCTCTCATCGACCTGTTCGGGAGCAGGGGCATGGGAGACGCCGCCGAC
CTGGTGGCGCTCTCCGGCGGCCACACCGTGGGGAAGTCAAAGTGCGCCTTCGTGAGGCCCGTGGACGACGCCTTCTCCCGGAAGATGGCCGCCAACTGCAGCGCCAACCCCAACACGAAG
CAGGACCTGGACGTCGTCACCCCCATCACCTTCGACAACGGCTACTACATAGCGCTCACCAGGAAGCAGGGGGTGTTCACCTCCGACATGGCGCTCATCCTGGACCCCCAAACTGCGGCC
ATCGTCAGGCGGTTCGCGCAGGACAAGGCCGCCTTCTTCACGCAGTTCGTTACGTCCATCGTCAAGCTGAGCAAGGTGCCGAGGCCCGGCGGGAACAAAGGCGAGATCCGCCGCAACTGC
TTCAAGACCAACAGCGGAGCACGCCTCGTGGACGTCGTGGAGGGCTTCGCTGCCTCTGCTTAA

Retrieve as FASTA