Entry information : PstrAPx-CcP
Entry ID 10712
Creation 2012-03-07 (Christophe Dunand)
Last sequence changes 2012-04-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Christophe Dunand)
Peroxidase information: PstrAPx-CcP
Name PstrAPx-CcP
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrAPx-CcP
start..stop
S start..stop
ShirAPx-CcP 380 6.17e-127 25..538 26..529
HanAPx-CcP04 360 4.65e-119 33..538 35..524
MvarAPx-CcP03 359 5.34e-119 5..399 8..402
CgeoAPx-CcP02 355 3.59e-117 24..538 29..512
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10712' 'join(58232..58616,58676..59006,59062..59175,59232..59413,59499..60127)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58232..58616 383 N° 2 58676..59006 329 N° 3 59062..59175 112 N° 4 59232..59413 180
N° 5 59499..60127 627  
join(58232..58616,58676..59006,59062..59175,59232..59413,59499..60127)


exon

Literature and cross-references PstrAPx-CcP
Cluster/Prediction ref. JGI gene:   75119 [Incorrect prediction]
Protein sequence: PstrAPx-CcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   546 (524)
PWM (Da):   %s   56597.47 (54530.4)  
PI (pH):   %s   8.25 (7.94) Peptide Signal:   %s   cut: 23 range:23-546
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPSLSAVSLTALVAAAQGVRGAYYPSAKYAALEHLLVDSTGHNA
NTFYKAVTPCGNYVSENSTKTGRVTSAQWMRVAFHDFATADVAAGTGGLDASIVFEYTRPENSGQAFPDSFNYWK
YYVGAQTS
FSDIIALGTVAAISSCGGPQLVYSAGRIDATAAGQFGVPEPDEGLTDTLARFAGAGISQTDAIKLTACGHTVGSVHHAGFPLVVGTDAVNANNTQGGINMDTTGTTYDNRIA
QEYVAGTTKNPLVTSFNVSQRSDLRLFSSDNNATMS
TLAESSSLFASECKRLTTQMLNTVPSGVSLTEITPIAVKPVNVTLTVNSAGTVTFSGAIRRRKVTITYTTADGKSTVTVPATTS
SSLVGSSTYLGGAATYYYAFSASVKGSSGIKSFVVKTQESSKAAVRTSGPFTFQDTVAFLPGSTSGKANTSALTISGTLSAAVRTDRKVKSVEAVITVPQPRDDGVPKPALATYTVPLSY
VRTLGRSSFALYQASGSTSLPSSLNYTLAAPLAAGASFDIVATLNDGSTVKDEYRTIQEASFTIV

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Incorrect prediction from JGI (last exon is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCGTCACTCAGCGCAGTTTCCCTCACGGCCCTTGTTGCGGCTGCCCAAGGAGTTAGGGGCGCGTACTACCCCTCCGCGAAGTACGCAGCGCTCGAGCATCTGCTGGTCGACTCC
ACCGGCCACAATGCGAATACATTCTACAAAGCCGTGACGCCCTGCGGCAATTACGTCTCGGAGAACAGCACCAAGACGGGCAGGGTCACCTCTGCGCAATGGATGCGAGTTGCCTTCCAT
GACTTCGCCACCGCCGATGTCGCCGCCGGTACGGGAGGCTTGGACGCAAGTATTGTCTTCGAGTACACTCGCCCAGAGAACTCGGGGCAGGCCTTCCCCGACAGCTTCAACTACTGGAAG
TACTACGTCGGCGCTCAGACGAGCT
CTGTAAGTCCCGCTCTCTTTGGCTGTTCCTTGCCATGACTGACATTGACGCGCCGGGCTAGTTTCCGACATAATCGCGTTGGGCACGGTCGCCGC
TATCTCGTCTTGCGGTGGGCCGCAGCTGGTGTACAGCGCCGGTCGTATTGATGCGACTGCCGCCGGCCAATTCGGCGTCCCCGAACCTGACGAGGGCCTCACCGACACCCTTGCACGGTT
CGCCGGAGCGGGTATATCGCAGACCGATGCGATCAAGCTCACTGCCTGTGGTCACACGGTTGGTAGCGTTCACCACGCTGGTTTCCCGCTCGTCGTCGGGACGGACGCTGTCAACGCCAA
CAACACCCAAGGCGGCATCAACATGGACACCACCGGTACCACCTATGATAACAGGAT
ATGTAAGTTTCAACTTCTTTGCGGCAATCGCTCTCGCTGACCTTCTCCGTTTCTTAGTGCGCA
GGAGTACGTGGCTGGCACGACCAAGAACCCGCTGGTCACGTCTTTCAATGTCTCCCAGCGCTCAGACTTGCGCCTGTTCTCTTCCGACAATAACGCGACGATGTCCAC
ACGTGGGTCTAT
TGCTATCCCTGCTAGTGCAAATCCGTCCTGACCATTGGACGCACAGATTGGCCGAGTCGAGCAGCCTCTTCGCCTCTGAGTGCAAGCGCCTCACTACGCAGATGCTGAACACCGTTCCCA
GCGGTGTATCCCTAACCGAGATCACGCCCATCGCCGTGAAGCCGGTCAATGTTACTCTCACCGTCAACTCTGCGGGAACCGTGACCTTCTCCGGTGCTATCCGCGTAA
AAGTAGCGAGTG
ATGCGATCATCGTGCTATCCATTCACACGTTCGATTTATCCTAGCTTCTCGGAACCCAGTTCTCCGCCAACTCAGGACGGAAGGTCACTATCACCTATACCACCGCGGATGGCAAGTCGA
CGGTTACCGTGCCCGCTACGACGTCGTCTTCCCTCGTCGGCTCCTCGACCTACCTTGGCGGCGCGGCGACCTACTACTACGCTTTCTCTGCGTCGGTCAAAGGCTCAAGCGGCATAAAGT
CCTTCGTCGTCAAAACTCAGGAGAGCTCGAAGGCTGCGGTGCGGACCTCCGGCCCATTCACCTTCCAGGACACTGTTGCCTTCCTCCCTGGCTCCACCAGTGGCAAGGCCAACACCTCCG
CGCTCACCATCTCCGGTACGCTCAGCGCTGCCGTCCGCACAGACCGCAAGGTGAAGAGCGTGGAAGCCGTCATCACCGTCCCGCAGCCGCGCGACGACGGCGTGCCGAAACCGGCGCTGG
CGACGTACACCGTCCCGCTGTCGTACGTCCGCACGCTCGGCAGGTCGAGTTTCGCACTCTACCAGGCCTCGGGTTCGACTTCGCTCCCGTCCTCGCTCAACTACACACTCGCTGCCCCGC
TCGCGGCTGGTGCATCGTTCGACATCGTGGCGACGCTCAATGACGGCAGCACCGTTAAGGACGAGTACCGCACCATCCAGGAGGCGTCCTTTACCATCGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCGTCACTCAGCGCAGTTTCCCTCACGGCCCTTGTTGCGGCTGCCCAAGGAGTTAGGGGCGCGTACTACCCCTCCGCGAAGTACGCAGCGCTCGAGCATCTGCTGGTCGACTCC
ACCGGCCACAATGCGAATACATTCTACAAAGCCGTGACGCCCTGCGGCAATTACGTCTCGGAGAACAGCACCAAGACGGGCAGGGTCACCTCTGCGCAATGGATGCGAGTTGCCTTCCAT
GACTTCGCCACCGCCGATGTCGCCGCCGGTACGGGAGGCTTGGACGCAAGTATTGTCTTCGAGTACACTCGCCCAGAGAACTCGGGGCAGGCCTTCCCCGACAGCTTCAACTACTGGAAG
TACTACGTCGGCGCTCAGACGAGCT
TTTCCGACATAATCGCGTTGGGCACGGTCGCCGCTATCTCGTCTTGCGGTGGGCCGCAGCTGGTGTACAGCGCCGGTCGTATTGATGCGACTGCC
GCCGGCCAATTCGGCGTCCCCGAACCTGACGAGGGCCTCACCGACACCCTTGCACGGTTCGCCGGAGCGGGTATATCGCAGACCGATGCGATCAAGCTCACTGCCTGTGGTCACACGGTT
GGTAGCGTTCACCACGCTGGTTTCCCGCTCGTCGTCGGGACGGACGCTGTCAACGCCAACAACACCCAAGGCGGCATCAACATGGACACCACCGGTACCACCTATGATAACAGGAT
TGCG
CAGGAGTACGTGGCTGGCACGACCAAGAACCCGCTGGTCACGTCTTTCAATGTCTCCCAGCGCTCAGACTTGCGCCTGTTCTCTTCCGACAATAACGCGACGATGTCCAC
ATTGGCCGAG
TCGAGCAGCCTCTTCGCCTCTGAGTGCAAGCGCCTCACTACGCAGATGCTGAACACCGTTCCCAGCGGTGTATCCCTAACCGAGATCACGCCCATCGCCGTGAAGCCGGTCAATGTTACT
CTCACCGTCAACTCTGCGGGAACCGTGACCTTCTCCGGTGCTATCCGCGTAA
GACGGAAGGTCACTATCACCTATACCACCGCGGATGGCAAGTCGACGGTTACCGTGCCCGCTACGACG
TCGTCTTCCCTCGTCGGCTCCTCGACCTACCTTGGCGGCGCGGCGACCTACTACTACGCTTTCTCTGCGTCGGTCAAAGGCTCAAGCGGCATAAAGTCCTTCGTCGTCAAAACTCAGGAG
AGCTCGAAGGCTGCGGTGCGGACCTCCGGCCCATTCACCTTCCAGGACACTGTTGCCTTCCTCCCTGGCTCCACCAGTGGCAAGGCCAACACCTCCGCGCTCACCATCTCCGGTACGCTC
AGCGCTGCCGTCCGCACAGACCGCAAGGTGAAGAGCGTGGAAGCCGTCATCACCGTCCCGCAGCCGCGCGACGACGGCGTGCCGAAACCGGCGCTGGCGACGTACACCGTCCCGCTGTCG
TACGTCCGCACGCTCGGCAGGTCGAGTTTCGCACTCTACCAGGCCTCGGGTTCGACTTCGCTCCCGTCCTCGCTCAACTACACACTCGCTGCCCCGCTCGCGGCTGGTGCATCGTTCGAC
ATCGTGGCGACGCTCAATGACGGCAGCACCGTTAAGGACGAGTACCGCACCATCCAGGAGGCGTCCTTTACCATCGTATAA

Retrieve as FASTA