Entry information : OsPrx62(LOC_Os04g59200.)
Entry ID 1072
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx62(LOC_Os04g59200.)
Name OsPrx62(LOC_Os04g59200.)
Class Class III peroxidase    [Orthogroup: Prx077]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx62
start..stop
S start..stop
OsPrx64 521 0 1..350 1..338
OsPrx63 488 8e-175 7..332 3..323
TaPrx66 430 6e-152 3..350 4..341
OsPrx61 426 1e-150 11..350 12..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35251507..35251749 243 N° 2 35250564..35251379 816  
complement(join(35250564..35251379,35251507..35251749))


exon

Literature and cross-references OsPrx62(LOC_Os04g59200.)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1N1
DNA ref. GenBank:   NC_008397.1 (35251749..35250567)
Protein sequence: OsPrx62(LOC_Os04g59200.)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (321)
PWM (Da):   %s   37169.91 (34158.2)  
PI (pH):   %s   6.5 (5.73) Peptide Signal:   %s   cut: 32 range:32-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAVSRSGRAVAVLQLVSTVVLLLSPPPAAASRRDMSVDFHAASCPQLETIVRSAVQAALQREIALAAGLLRIFFHDCFPQGCDASVYLNATNPNTEQFPQGPNETLQPRALQLVEDIRAKVHAECGPTVSCADISALATRDAVVVSGGPSYAVPLGQQDSLAPASVDLVGDLPGPSTSRVQALIDLFATRGLGDPADLVALSGGHTVGRARCDFFRDRAGRQDDTFSKKLKLNCTKDPNRLQELDVITPDAFDNAYYIALTTGQGVFTSDMALMKNQTTASIVRQFAQDKAAFFDQFAKSMVKLSKVPRPGGNVGEIRRSCFLSNSNGPRLDLVVAAATDQDPGFAASASA*

Retrieve as FASTA  
Remarks chromosome 4. 19 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAGTGAGCAGAAGCGGCCGCGCAGTGGCCGTCCTGCAGCTTGTCTCCACCGTCGTCCTCCTCCTCTCGCCACCACCAGCAGCTGCATCTCGCCGTGACATGTCTGTGGACTTC
CACGCTGCGTCGTGCCCGCAGCTGGAGACCATCGTGCGCTCCGCCGTGCAGGCGGCGCTCCAGCGGGAGATCGCCCTCGCCGCCGGTCTCCTCCGCATCTTCTTCCACGACTGCTTCCCA
CAG
GTCACCTCTAGCTACTCTACGTGCGCCCTTATTACTGTACTAATTAATACAGTACTGTGTTGTATGTATGTACGTATATAAGGTATAGGATCGGAGTACGTAACTAAATGGACATGT
ATACGTACAGGGGTGCGACGCGTCGGTATATCTGAATGCCACCAACCCCAACACGGAGCAGTTTCCCCAGGGACCCAACGAGACGCTGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACAT
CCGCGCCAAGGTGCACGCCGAATGCGGTCCCACTGTCTCCTGCGCCGACATCTCCGCCCTCGCCACCCGCGACGCCGTCGTCGTCTCCGGCGGCCCCTCTTACGCCGTGCCACTCGGCCA
GCAAGACAGCCTCGCTCCGGCATCGGTGGATCTCGTCGGAGATCTCCCGGGCCCGAGCACCTCCAGAGTCCAGGCTCTCATCGACCTTTTCGCGACCAGGGGCCTGGGAGATCCTGCCGA
CCTGGTGGCGCTCTCCGGCGGCCACACCGTCGGGAGAGCACGCTGCGACTTCTTCCGTGACCGCGCGGGGCGCCAGGACGACACCTTCTCCAAGAAGCTGAAGTTGAACTGCACCAAGGA
CCCCAACCGGCTGCAGGAGCTTGACGTGATAACGCCCGACGCCTTCGACAACGCCTACTACATCGCGCTCACCACCGGCCAGGGTGTCTTCACTTCCGACATGGCGCTCATGAAGAACCA
GACCACGGCGTCCATCGTCAGGCAGTTCGCGCAGGACAAGGCCGCCTTCTTCGACCAGTTTGCCAAGTCCATGGTCAAGCTCAGCAAGGTACCCAGGCCCGGCGGGAACGTCGGCGAGAT
CCGCCGCAGCTGCTTCCTTTCCAACTCCAACGGACCACGCCTCGACCTCGTCGTCGCCGCCGCCACCGACCAAGACCCCGGTTTCGCTGCCTCTGCGTCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCAGTGAGCAGAAGCGGCCGCGCAGTGGCCGTCCTGCAGCTTGTCTCCACCGTCGTCCTCCTCCTCTCGCCACCACCAGCAGCTGCATCTCGCCGTGACATGTCTGTGGACTTC
CACGCTGCGTCGTGCCCGCAGCTGGAGACCATCGTGCGCTCCGCCGTGCAGGCGGCGCTCCAGCGGGAGATCGCCCTCGCCGCCGGTCTCCTCCGCATCTTCTTCCACGACTGCTTCCCA
CAG
GGGTGCGACGCGTCGGTATATCTGAATGCCACCAACCCCAACACGGAGCAGTTTCCCCAGGGACCCAACGAGACGCTGCAGCCGCGGGCGCTGCAGCTGGTGGAGGACATCCGCGCC
AAGGTGCACGCCGAATGCGGTCCCACTGTCTCCTGCGCCGACATCTCCGCCCTCGCCACCCGCGACGCCGTCGTCGTCTCCGGCGGCCCCTCTTACGCCGTGCCACTCGGCCAGCAAGAC
AGCCTCGCTCCGGCATCGGTGGATCTCGTCGGAGATCTCCCGGGCCCGAGCACCTCCAGAGTCCAGGCTCTCATCGACCTTTTCGCGACCAGGGGCCTGGGAGATCCTGCCGACCTGGTG
GCGCTCTCCGGCGGCCACACCGTCGGGAGAGCACGCTGCGACTTCTTCCGTGACCGCGCGGGGCGCCAGGACGACACCTTCTCCAAGAAGCTGAAGTTGAACTGCACCAAGGACCCCAAC
CGGCTGCAGGAGCTTGACGTGATAACGCCCGACGCCTTCGACAACGCCTACTACATCGCGCTCACCACCGGCCAGGGTGTCTTCACTTCCGACATGGCGCTCATGAAGAACCAGACCACG
GCGTCCATCGTCAGGCAGTTCGCGCAGGACAAGGCCGCCTTCTTCGACCAGTTTGCCAAGTCCATGGTCAAGCTCAGCAAGGTACCCAGGCCCGGCGGGAACGTCGGCGAGATCCGCCGC
AGCTGCTTCCTTTCCAACTCCAACGGACCACGCCTCGACCTCGTCGTCGCCGCCGCCACCGACCAAGACCCCGGTTTCGCTGCCTCTGCGTCTGCTTGA

Retrieve as FASTA