Entry information : SrosCcP001 (Sporo-CCP1)
Entry ID 10723
Creation 2012-03-08 (Christophe Dunand)
Last sequence changes 2012-03-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-27 (Catherine Mathe (Scipio))
Peroxidase information: SrosCcP001 (Sporo-CCP1)
Name (synonym) SrosCcP001 (Sporo-CCP1)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Sporobolomyces
Organism Sporobolomyces roseus    [TaxId: 40563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SrosCcP001
start..stop
S start..stop
RgraCcP02 511 0 1..366 1..356
MvioCcP02 448 8e-159 77..361 51..337
OmaiCcP02 422 2e-148 10..353 18..353
CqueCcP02 417 2e-146 40..368 43..374
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1972249..1972585 337 N° 2 1971680..1972148 469 N° 3 1971490..1971601 112 N° 4 1971283..1971392 110
N° 5 1971108..1971186 79  
complement(join(1971108..1971186,1971283..1971392,1971490..1971601,1971680..1972 148,1972249..1972585))


exon

Literature and cross-references SrosCcP001 (Sporo-CCP1)
DNA ref. JGI genome:   scaffold_1 (1972585..1971108)
Cluster/Prediction ref. JGI gene:   16456
Protein sequence: SrosCcP001 (Sporo-CCP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   369
PWM (Da):   %s   40448.01  
PI (pH):   %s   8.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFTSSFLRSTPRLASRTAFATSASSSSRHALRRHLATASGSSSAGGGSSNAFLYGLLGAGALGGGAYYFTTRNPTADEDPRKIRDAASPKEVDYQKVYNAIADVLEEEGYDDGSYGPVLVRLAWHCSGTYDKESNSGGSNGATMRFAPEANHGANAGLEKARQRLEKVKAQFPEISYSDLWTLAGVVAVQELGGPYVPWKAGRKDGNVEHCTPDGRLPDGDKGGDHIRKIFYRMGFNDQEIVALSGAHALGRCHVDRSGFDGPWSYSPITFSNEYYRLLFDEKWQERKWKGPPQYENKSDKSLMMLRTDMALATDKGFKPTAQLYAKDEEKFFSDFSNVFSKLIHLGVPQSQLSEVVQLKKLEDQKA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCACGTCTTCCTTCTTGCGCTCGACGCCTCGCCTCGCTTCCCGCACCGCGTTCGCTACCTCTGCCTCTTCCTCCTCTCGCCACGCCCTCCGTCGCCACCTCGCGACCGCCTCT
GGTTCGTCATCTGCCGGTGGAGGATCGTCGAACGCGTTCTTGTACGGTCTCCTCGGAGCCGGAGCCCTCGGAGGTGGAGCTTACTACTTTACTACTCGCAACCCTACCGCCGATGAAGAC
CCTAGGAAGATCAGGGACGCTGCTTCTCCGAAAGAAGTCGATTACCAAAAAGTCTACAATGCGATCGCTGACGTTCTCGAGGAAGAAGGGTACGATG
GTTAGTTTTATCTTTTCTTTTTT
CATTTTCGTTCTCAACTCCTTTTTCTCCCTTTTGTGGGCTCCTAACCGACTCGATCGCGATCGTTCACATCGCATAGATGGATCTTACGGACCTGTCCTCGTTCGTCTCGCGTGGCACTG
TTCGGGAACGTATGACAAGGAATCAAACTCTGGAGGTTCGAACGGTGCGACGATGAGGTTCGCCCCCGAAGCGAACCACGGTGCCAACGCCGGATTGGAAAAGGCTCGTCAACGACTCGA
AAAAGTCAAGGCGCAGTTCCCCGAGATCTCGTACTCGGACTTGTGGACTTTGGCCGGAGTCGTCGCAGTTCAAGAACTCGGAGGTCCTTACGTACCTTGGAAGGCGGGTAGGAAGGATGG
AAACGTCGAACACTGTACCCCTGATGGACGACTTCCCGATGGAGACAAGGGTGGAGATCACATCAGGAAGATTTTCTACCGCATGGGATTCAACGATCAAGAGATTGTCGCACTTTCCGG
GGCTCACGCCCTTGGAAGGTGTCACGTTGATCGTTCTGGATTCGATGGACCTTGGTCTTACTCTCC
GTAAGTCGTCGACTCTCTTTAATCTTCTCGTTTGTTTCCCGCTAATGATGATCC
TGTGCATTGTTTTTCGTATCGTAGCATCACGTTCTCGAACGAGTACTACCGTCTCTTGTTTGATGAGAAGTGGCAAGAACGCAAGTGGAAGGGTCCTCCTCAATACGAAAACAAGTCTGA
CAAGTCTTTGATGATG
GTCAGTCTTCTTCTCCTTTCTGCCTCGTTGTCTCTTCGGGATCGGATCGAATAGCTCACCTTTCTTTTTTACTCTGCGTCTCCTCACTGTGATTCAGCTCCGTA
CCGACATGGCCCTCGCGACTGACAAGGGATTCAAGCCTACCGCTCAACTATACGCCAAGGACGAAGAAAAGTTCTTCTCTGATTTCTCAAACGTCTTCTCAAA
GTCAGTCCTCGCCCCTC
ACAACGCTCTCTCTCTCTGTTCGTGTCTATCGTGTCTACGCTGTTCCGCTACTGACTGTGTTGAATTCTTCGCGCGCAGGCTCATCCACCTCGGAGTTCCTCAATCTCAACTCTCCGAGG
TTGTTCAACTCAAGAAACTCGAGGATCAAAAGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTCACGTCTTCCTTCTTGCGCTCGACGCCTCGCCTCGCTTCCCGCACCGCGTTCGCTACCTCTGCCTCTTCCTCCTCTCGCCACGCCCTCCGTCGCCACCTCGCGACCGCCTCT
GGTTCGTCATCTGCCGGTGGAGGATCGTCGAACGCGTTCTTGTACGGTCTCCTCGGAGCCGGAGCCCTCGGAGGTGGAGCTTACTACTTTACTACTCGCAACCCTACCGCCGATGAAGAC
CCTAGGAAGATCAGGGACGCTGCTTCTCCGAAAGAAGTCGATTACCAAAAAGTCTACAATGCGATCGCTGACGTTCTCGAGGAAGAAGGGTACGATG
ATGGATCTTACGGACCTGTCCTC
GTTCGTCTCGCGTGGCACTGTTCGGGAACGTATGACAAGGAATCAAACTCTGGAGGTTCGAACGGTGCGACGATGAGGTTCGCCCCCGAAGCGAACCACGGTGCCAACGCCGGATTGGAA
AAGGCTCGTCAACGACTCGAAAAAGTCAAGGCGCAGTTCCCCGAGATCTCGTACTCGGACTTGTGGACTTTGGCCGGAGTCGTCGCAGTTCAAGAACTCGGAGGTCCTTACGTACCTTGG
AAGGCGGGTAGGAAGGATGGAAACGTCGAACACTGTACCCCTGATGGACGACTTCCCGATGGAGACAAGGGTGGAGATCACATCAGGAAGATTTTCTACCGCATGGGATTCAACGATCAA
GAGATTGTCGCACTTTCCGGGGCTCACGCCCTTGGAAGGTGTCACGTTGATCGTTCTGGATTCGATGGACCTTGGTCTTACTCTCC
CATCACGTTCTCGAACGAGTACTACCGTCTCTTG
TTTGATGAGAAGTGGCAAGAACGCAAGTGGAAGGGTCCTCCTCAATACGAAAACAAGTCTGACAAGTCTTTGATGATG
CTCCGTACCGACATGGCCCTCGCGACTGACAAGGGATTCAAG
CCTACCGCTCAACTATACGCCAAGGACGAAGAAAAGTTCTTCTCTGATTTCTCAAACGTCTTCTCAAA
GCTCATCCACCTCGGAGTTCCTCAATCTCAACTCTCCGAGGTTGTTCAACTC
AAGAAACTCGAGGATCAAAAGGCTTAA

Retrieve as FASTA