Entry information : OsPrx63(LOC_Os04g59210)
Entry ID 1073
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2010-08-03 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx63(LOC_Os04g59210)
Name OsPrx63(LOC_Os04g59210)
Class Class III peroxidase    [Orthogroup: Prx067]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx63
start..stop
S start..stop
OsPrx64 576 0 2..331 3..331
OsPrx62 488 8.05e-175 3..323 7..332
TaPrx66-2D 443 1.47e-157 12..331 14..334
TaPrx66-2A 442 3.95e-157 12..325 14..326
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1073' 'complement(join(35258000..35258779,35258870..35259097))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35258870..35259097 226 N° 2 35258000..35258779 778  
complement(join(35258000..35258779,35258870..35259097))


exon

Literature and cross-references OsPrx63(LOC_Os04g59210)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1N0
DNA ref. GenBank:   NC_008397.1 (35259097..35258003)
Protein sequence: OsPrx63(LOC_Os04g59210)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (307)
PWM (Da):   %s   35496.42 (32648.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.58 (8.40) Peptide Signal:   %s   cut: 29 range:29-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAARRLPVLELVSFVAVLLISSPTAAAAELSVDFHAASCPPLEA
IVRSSVQAALQQEIALAAGLLRIFFHDCLPQ
GCDASVYLRGGSNSEQGMGPNLTLQPRALQLVDDIRAKVHAACGPTVSCADISALATRDAVVVSGGPSYAVSLGQKDSLAPAPVRLVNQLPGPGTSSVQALLDKFGSKGLREAADLVALS
GAHTVGRAHCDFFRDRAARQDDTFSKKLAVNCTKDPNRLQNLDVVTPDAFDNAYYVALTRKQGVFTSDMALIKDRITAPIVRQFAADKAAFFRQFAKSMVKLSQVPRTDRNVGEIRRSCF
RTNGPRLVDLATGDEAASP*

Retrieve as FASTA  
Remarks chromosome 4. No ESTs. TC272221
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCGAGGAGACTGCCCGTCCTGGAGCTGGTCTCCTTCGTCGCCGTCCTCCTTATCTCCTCACCAACAGCAGCAGCAGCCGAGTTGTCTGTGGACTTCCACGCGGCGTCGTGC
CCGCCGCTGGAGGCCATCGTGCGCTCCTCAGTGCAAGCCGCGCTGCAGCAAGAGATCGCCCTCGCCGCCGGCCTCCTCCGCATCTTCTTCCACGACTGCCTCCCGCAG
GCACGCACGCAA
GAACATACTCCTATATTCGCACGTACGTACGAACAATAATGTTGTACTCAACTGAACATGCTGCATATGCATGTGCAGGGGGGTGCGATGCATCGGTGTATCTGAGGGGAGGCAGCAACT
CAGAGCAGGGCATGGGCCCAAACCTGACGCTGCAGCCGCGGGCGCTGCAGCTCGTCGACGACATCCGCGCCAAGGTGCATGCAGCATGCGGCCCCACCGTCTCCTGCGCCGACATCTCCG
CGCTCGCCACCCGTGACGCCGTCGTCGTCTCCGGGGGACCCTCGTACGCAGTGTCTCTCGGCCAAAAAGACAGCCTCGCCCCGGCCCCGGTGCGCCTCGTCAACCAACTCCCGGGCCCGG
GCACCTCCAGCGTCCAGGCTCTCCTCGACAAATTCGGAAGCAAGGGCCTCAGAGAGGCCGCCGACCTGGTGGCGCTTTCCGGCGCCCACACCGTCGGGAGGGCGCACTGCGACTTCTTCC
GTGACCGCGCCGCCCGCCAGGACGACACCTTCTCCAAGAAGCTGGCCGTGAACTGCACCAAGGACCCCAACCGGCTGCAGAATCTGGACGTCGTCACGCCCGACGCCTTCGACAACGCCT
ACTACGTCGCGCTCACCAGGAAGCAGGGGGTGTTCACCTCCGATATGGCGCTCATCAAGGACCGGATCACGGCGCCAATCGTCAGGCAGTTCGCCGCGGACAAGGCCGCATTCTTCAGGC
AGTTCGCCAAGTCCATGGTCAAGCTCAGCCAGGTTCCGAGGACTGACAGGAACGTCGGCGAGATCCGCCGCAGCTGCTTCAGGACCAACGGACCACGCCTCGTCGACTTGGCCACCGGCG
ATGAGGCCGCTTCTCCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCGAGGAGACTGCCCGTCCTGGAGCTGGTCTCCTTCGTCGCCGTCCTCCTTATCTCCTCACCAACAGCAGCAGCAGCCGAGTTGTCTGTGGACTTCCACGCGGCGTCGTGC
CCGCCGCTGGAGGCCATCGTGCGCTCCTCAGTGCAAGCCGCGCTGCAGCAAGAGATCGCCCTCGCCGCCGGCCTCCTCCGCATCTTCTTCCACGACTGCCTCCCGCAG
GGGTGCGATGCA
TCGGTGTATCTGAGGGGAGGCAGCAACTCAGAGCAGGGCATGGGCCCAAACCTGACGCTGCAGCCGCGGGCGCTGCAGCTCGTCGACGACATCCGCGCCAAGGTGCATGCAGCATGCGGC
CCCACCGTCTCCTGCGCCGACATCTCCGCGCTCGCCACCCGTGACGCCGTCGTCGTCTCCGGGGGACCCTCGTACGCAGTGTCTCTCGGCCAAAAAGACAGCCTCGCCCCGGCCCCGGTG
CGCCTCGTCAACCAACTCCCGGGCCCGGGCACCTCCAGCGTCCAGGCTCTCCTCGACAAATTCGGAAGCAAGGGCCTCAGAGAGGCCGCCGACCTGGTGGCGCTTTCCGGCGCCCACACC
GTCGGGAGGGCGCACTGCGACTTCTTCCGTGACCGCGCCGCCCGCCAGGACGACACCTTCTCCAAGAAGCTGGCCGTGAACTGCACCAAGGACCCCAACCGGCTGCAGAATCTGGACGTC
GTCACGCCCGACGCCTTCGACAACGCCTACTACGTCGCGCTCACCAGGAAGCAGGGGGTGTTCACCTCCGATATGGCGCTCATCAAGGACCGGATCACGGCGCCAATCGTCAGGCAGTTC
GCCGCGGACAAGGCCGCATTCTTCAGGCAGTTCGCCAAGTCCATGGTCAAGCTCAGCCAGGTTCCGAGGACTGACAGGAACGTCGGCGAGATCCGCCGCAGCTGCTTCAGGACCAACGGA
CCACGCCTCGTCGACTTGGCCACCGGCGATGAGGCCGCTTCTCCTTGA

Retrieve as FASTA