Entry information : PindLDS01
Entry ID 10734
Creation 2012-03-09 (Christophe Dunand)
Last sequence changes 2012-03-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-09 (Christophe Dunand)
Peroxidase information: PindLDS01
Name PindLDS01
Class Linoleate diol synthase (PGHS like)    [Orthogroup: LDS001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sebacinaceae Piriformospora
Organism Piriformospora indica    [TaxId: 65672 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PindLDS01
start..stop
S start..stop
JargLDS01 771 0 243..1250 138..1067
JargLDS01 59 0.00000000697 58..151 42..134
LbiLDS01 728 0 243..1250 146..1070
LbiLDS01 55 0.000000166 85..135 68..118
AbLDS01_burnettii 706 0 212..1252 116..1084
AbLDS01_burnettii 50 0.00000521 1..143 1..129
CcinLDS01 706 0 243..1252 134..1088
CcinLDS01 52 0.00000135 23..135 6..116
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10734' 'join(3249..3272,3476..3634,3688..4761,4813..5166,5217..5407,5466..5712,5762..5948,5997..6129,6177..6438,6485..6661,6708..6793,6843..6969,7021..7195,7246..7514,7563..7645,7694..7721,7770..7849,7898..7988,8036..8047)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3249..3272 22 N° 2 3476..3634 157 N° 3 3688..4761 1072 N° 4 4813..5166 352
N° 5 5217..5407 189 N° 6 5466..5712 245 N° 7 5762..5948 185 N° 8 5997..6129 131
N° 9 6177..6438 260 N° 10 6485..6661 175 N° 11 6708..6793 84 N° 12 6843..6969 125
N° 13 7021..7195 173 N° 14 7246..7514 267 N° 15 7563..7645 81 N° 16 7694..7721 26
N° 17 7770..7849 78 N° 18 7898..7988 89 N° 19 8036..8047 10  
join(3249..3272,3476..3634,3688..4761,4813..5166,5217..5407,5466..5712,5762..594 8,5997..6129,6177..6438,6485..6661,6708..6793,6843..6969,7021..7195,7246..7514,7 563..7645,7694..7721,7770..7849,7898..7988,8036..8047)


exon

Literature and cross-references PindLDS01
Protein sequence: PindLDS01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   1252
PWM (Da):   %s   138458.28  
PI (pH):   %s   7.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTFVNSLLSAGQLADVVNRSYRGLPISQDGLSDEQAAPATENKREQEAWLLHAAKGLDAQIRRGLPLSPSAIPSFIDAFLHAQTSTGIDDRKLLLENVLAFMSRLPPGPIQSKVQDAVI
QLFWDALPHPPNSFLPSMQVEPENVTEINGVRIGPGGYANVSRRRIGRTQVPPNSKPGAGASTTLPVPAAPAPVQQLPTPAPSGFVNGPAKPANGSTAPVDPTQTISLSPENRIPTKAYS
SQFRTPSGAQNNLILPLLGAAGSPYARSVVPQHPVPHTILPDPGLVFDLLMRRRDPPSAAVKPAPGKPSRDYDPRVEAQFRSQGHGQRHPSGLSTMLFAFGDLIIHSLFRTSSDDSNVNL
TSSYLDLSVLYGVDEAEMQTVRRYDGTGRIWEDCWADPRLFGMPPAVLAVLIVFSRNHN
YVALRLLEINEARQYTSPSISPPKSNHVGADQIFPTLSGDPDKLRAQDDDIFNRARLINCA
FFMNVILGDYLSGILGTFREASEWCLNPLEEIRKGGKTACPRAEGNCVSVEFNLLYR
WHATMSHKDVDWLEMLVKKALPGEARIQSAPPGQLELSEDDYKAVAGMFAKFQAGAVRDRVFGGLKRTPEGGFADSDLARILHEATDTVACAYGARGIPSVMKAIEVMGIKQGRKWGVCSLNEFRKFVGLKQYESFEEWNPTGDIKVARNLYQHIDNLELYVGLMCEESKNPGPGAGLCPGYT
ISRAILADAVCLTRGDRFLTTDLT
PFNLTSWGFQDCARDTKNGSLGGMFSKLLFRTLPDHYPASSIYAHFPFFTPPEMKHWLTEMKLIQNYNVDRPSSDPVRPTQSINSAQGIDRVLKDM
STFNTVYGDSIRYLSNGYGFFLAFDEEPKHRDARR
MHAALYRDGAMKKYAEFYQREATRLIRLRSFETGPKSRGVNIVRDVINIVPVHWVSEELAGLPLKSEEAPRGLFTEQEMYGMFAC
VF
TFIFLNIEPSNDWPLRQNSLKFSEIITGFVKARLQKIAGEGSFSLQGLKDTVLQFFTDKVDNSDEFYRTILNGNNGKYTIDQLASNVFAMIVASVANFAQATTHVVDFYLDKEREEEF
KHLKDLSMDKTAEADALLAGYAREGLRFRPQAPGIFRRATKDVTVVEGNGLKPVDIKAGDRIFVSLTHAGM
PSVFPDPTKVDPRRPREAYYAFGRGEHTCLGAMFTEMIPAVLRAVFSLP
NVRRGPGYSGTLN
TFKHDLFGTESHLYISNKGTVSPWPAFMMIYDV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (18 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACATTTGTAAACTCCCTCTCGTACGTTCTTCTGTCCCCATTCTCAAAACCTGCGCGCTAACTGACTTGCTGCTCGTTGACCGCCGCCTCGTGTATGCTCGCCCTGTACTCGACG
CGGCTATTCGTTTCTTTGGATTCTCGTCTTTCTACTGGTTACTTGATACCCGACCCCGGAACTTGACAACTTCCGCTCAATTGTCTAAATGCACGCCACTATCCCATAGTTGTCCGCTGG
ACAGCTGGCAGATGTCGTAAACCGCTCTTATCGTGGTCTCCCAATCAGTCAAGACGGTCTCTCAGACGAACAGGCTGCTCCCGCGACGGAAAACAAGCGCGAACAAGAGGCCTGGTTGTT
GCACGCCGCCAAAGGACTCGATGCTCAG
AGGTACATATATGCATTCTCCTCTCAATTTTCTTCGTATTCACACGGCCCTGCAGATCAGACGAGGACTTCCGCTCTCGCCAAGCGCAATTC
CGTCGTTTATTGATGCCTTTTTGCATGCTCAGACATCGACCGGAATCGATGACCGCAAACTGCTTTTGGAAAACGTTCTCGCGTTCATGTCCCGTCTTCCTCCTGGCCCAATCCAGAGCA
AGGTCCAAGACGCAGTCATTCAACTCTTTTGGGACGCGCTCCCACACCCGCCGAACAGCTTTCTCCCAAGTATGCAGGTCGAACCAGAGAATGTCACCGAGATCAACGGCGTTCGCATTG
GCCCTGGAGGGTATGCCAACGTAAGCCGAAGAAGGATTGGCCGCACTCAAGTTCCTCCAAATTCCAAACCTGGAGCCGGCGCATCCACCACCCTTCCCGTCCCAGCTGCTCCCGCTCCGG
TGCAGCAACTTCCCACGCCGGCTCCTTCTGGCTTTGTCAATGGACCCGCAAAGCCTGCAAACGGTTCGACTGCTCCAGTCGACCCAACTCAGACCATCTCTCTTTCACCAGAAAATCGTA
TCCCGACAAAGGCCTATTCAAGCCAGTTCCGTACGCCCTCTGGAGCGCAGAATAATCTCATCCTACCCCTCCTTGGTGCTGCAGGAAGTCCCTATGCACGCTCCGTCGTCCCTCAGCATC
CAGTTCCTCATACGATTCTCCCCGACCCAGGTCTCGTCTTTGACTTGCTCATGCGTCGAAGGGATCCTCCCTCGGCTGCCGTCAAGCCCGCTCCAGGAAAGCCCTCCAGGGATTATGACC
CGCGCGTCGAAGCGCAATTCCGCTCTCAGGGACACGGCCAGCGCCATCCAAGCGGGTTGAGCACCATGTTGTTCGCGTTTGGTGATTTGATCATCCACTCGTTGTTCCGCACTAGCAGCG
ACGACTCGAATGTCAACCTCACCAGCAGCTATCTCGATCTTAGCGTGCTCTATGGTGTTGACGAGGCGGAGATGCAGACCGTGAGGCGATATGATGGTACCGGTCGTATCTGGGAGGACT
GCTGGGCAGACCCACGTCTTTTTGGTATGCCTCCTGCCGTCTTGGCCGTCTTGATCGTCTTTTCAAGGAACCACAAC
ACGTGAGTGACCGCCCCCAACCTTTTCCTGAACACTTGCTGAT
TTTTGACTAGTACGTTGCATTGAGACTGCTCGAGATCAACGAGGCACGTCAGTATACTTCACCGAGCATATCACCACCAAAGTCGAATCACGTTGGTGCCGACCAAATCTTCCCCACGCT
CTCGGGTGATCCAGACAAACTGCGCGCGCAAGACGATGACATTTTCAACCGTGCAAGATTGATCAACTGTGCATTCTTCATGAACGTTATTCTTGGCGATTATCTCTCTGGTATCCTCGG
TACCTTCCGCGAGGCGAGCGAATGGTGCCTCAACCCACTCGAGGAGATTCGCAAGGGTGGGAAGACGGCTTGTCCTCGTGCAGAGGGCAACTGCGTCAGCGTCGAGTTTAACCTTCTCTA
TCGC
GCGTGCGTTGCTTTGATTCCTTTGACGATGACATTTTGACAATCTTCCCTAGTGGCATGCTACCATGTCCCACAAGGACGTCGATTGGCTTGAGATGCTAGTCAAAAAGGCACTTC
CTGGCGAGGCTCGTATCCAATCTGCACCCCCCGGTCAACTTGAATTGTCAGAGGATGATTACAAGGCCGTTGCAGGCATGTTTGCCAAATTCCAAGCGGGAGCTGTTCGCGATCGCGTAT
TCGGAGG
GGGTCAGTTCTACTCATGCTCCCGAGTTGAAAATGCAAATTAATCGTTTTTTTTTTGTAGATTGAAGCGTACGCCCGAAGGTGGCTTCGCGGACTCTGACCTCGCGCGTATCC
TCCACGAAGCGACGGATACGGTTGCTTGTGCGTATGGTGCCAGGGGTATCCCATCCGTCATGAAGGCTATCGAGGTCATGGGTATCAAGCAAGGTCGCAAGTGGGGTGTCTGCTCTCTCA
ACGAGTTCCGCAAATTTGTGGGACTCAAGCAATACGAGAGCTTTGAAGAGTGGAACCCGACGGGCGATATCGCT
CTGTACGTCCACTCTTTTGTGCTGTAGGATGTTTATTGACGCCTCC
TATAGAAAGTCGCTAGGAATCTTTATCAGCACATTGACAACCTGGAACTCTATGTCGGTTTGATGTGCGAGGAATCAAAGAATCCTGGTCCAGGTGCTGGTCTTTGCCCTGGGTACACCA
TTTCCCGTGCCATCCTAGCAGATGCAGTTTGCTTGACGCGAGGAGATCGATTCTTGACCACTGATCTTACGC
GCGTAAGTTGCCTTTTGGGACGGTTTTTGTTGACGCTGACTGCTCTAT
AGCGTTCAATTTGACATCATGGGGCTTCCAGGATTGCGCTCGAGATACGAAGAATGGATCCCTTGGAGGCATGTTCAGCAAGCTTCTCTTCCGTACTCTCCCGGATCACTATCCGGCTAG
CTCCATCTACGCACA
CAGTACGTTCGTCCAGGGCTCGACTTTGCGCATGCTCACTTATTTCTAGCTTCCCCTTCTTCACACCACCGGAGATGAAACACTGGCTTACAGAGATGAAGTTGA
TCCAGAACTATAACGTCGACAGGCCCTCTAGCGATCCCGTTCGCCCCACGCAGTCGATCAACTCTGCCCAGGGCATCGACCGTGTGCTCAAGGACATGTCAACGTTCAACACAGTCTACG
GGGACAGTATTCGCTACCTTAGCAACGGCTACGGATTCTTCCTTGCGTTTGACGAGGAGCCCAAGCATCGTGATGCTCGTCGTTTG
TGGTATGCGTCGTTACATTGGCAATATTTTGTGC
TGACTATCGCATAGATGCACGCTGCGCTTTATCGCGATGGTGCGATGAAGAAATATGCCGAGTTTTACCAGAGAGAGGCGACTCGTCTCATCAGGTTGAGGTCGTTTGAGACTGGGCCCA
AGTCGAGAGGCGTGAATATTGTTCGTGATGTGATCAATATCGTCCCTGTGCACTGGGTGTCCGAGGAACTC
TCGTGAGTGAGCTCATTACGTAGATTGGCATCCGCTCACGCATTCTAGG
CCGGACTTCCTCTCAAGTCGGAGGAAGCTCCACGGGGTCTGTTCACGGAGCAAGAGATGTATGGCATGTTTGCCTGCGTTTTCAC
ACGTATGTGTCTGGGGGGGCTTTGATGGCTGGTCT
CTGACGCACTGTCCAGGTTCATTTTCTTGAACATTGAGCCGTCCAACGATTGGCCACTTCGCCAGAATTCCCTCAAGTTTTCCGAGATTATCACTGGATTCGTCAAAGCGCGTCTGCAAA
AGATTGCTGGAGAGGGCTCTTTG
TGGTTTGTAAATTCCTTGGGTTTGGGCACCAAACTGAGATTGGTCGTGGACAGTTCTCTTTGCAGGGATTAAAGGACACGGTTCTCCAGTTCTTCAC
GGACAAAGTCGACAATAGTGACGAGTTTTATCGCACAATCCTCAACGGAAACAACGGCAAGTATACCATTGATCAGTTGGCTTCCAATGTCTTTGCCATGATCGTCGCCAGCGTTGCCAA
CTTTGCTCAGG
GGGTGAGTGCGATTGTCATTCTTTAATACCGCTTCTCATTCTTTATTGCCAGCGACCACCCACGTTGTGGACTTCTACTTGGACAAGGAGAGGGAGGAAGAGTTCAAGC
ATCTCAAGGATCTCTCCATGGACAAGACTGCCGAGGCGGATGCTCTTCTCGCTGGTTATGCTCGCGAGGGACTTCGCTTCCGGCCACAGGCACCTGGTATCTTTAGACGTGCAACCAAGG
ACGTGACAGTGGTAGAAGGAAACGGCCTCAAGCCGGTTGATATCAAGGCTGGAGACCGCATCTTTGTCAGCCTTACGCATGCGGGCATGGAT
ATGTGAGTGTCTCTCTCCTTTAGAGATG
TGTTTGCTAATGCTGTTCTCAGCCAAGCGTCTTCCCTGATCCGACCAAGGTTGATCCTAGACGCCCGAGGGAAGCATACTACGCGTTTGGTCGTGGGGAGCATACACGTAAGTGATGAGT
GGACCAAGTTAACATGGCGACTGACTCTTGGATAGTTGCCTCGGCGCCATGTTCACCGAAACGCGGTATGTCGAATGTACGTTGATTGCGACTTGAGTCTTACGTCTCTGTAGATGATCC
CCGCAGTGCTTCGTGCCGTCTTTAGTCTCCCCAACGTTCGCCGAGGACCGGGATATTCTGGAACGCTGAATAC
ACGTGAGTAGCGCTAGCTTGAGCGGGCCATGTCACTAACGACCTTGT
TAGGTTCAAACACGACCTGTTTGGAACGGAGAGCCATCTGTACATCTCGAACAAGGGCACTGTAAGTCCTTGGCCGGCGTTTATGATGATCGAGAGGTATGTCGTTTCCTCCCCAGTCTA
CACATTGATCTCACATTTCCTAGTACGACGTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTACATTTGTAAACTCCCTCTTGTCCGCTGGACAGCTGGCAGATGTCGTAAACCGCTCTTATCGTGGTCTCCCAATCAGTCAAGACGGTCTCTCAGACGAACAGGCTGCTCCCGCG
ACGGAAAACAAGCGCGAACAAGAGGCCTGGTTGTTGCACGCCGCCAAAGGACTCGATGCTCAG
ATCAGACGAGGACTTCCGCTCTCGCCAAGCGCAATTCCGTCGTTTATTGATGCCTTT
TTGCATGCTCAGACATCGACCGGAATCGATGACCGCAAACTGCTTTTGGAAAACGTTCTCGCGTTCATGTCCCGTCTTCCTCCTGGCCCAATCCAGAGCAAGGTCCAAGACGCAGTCATT
CAACTCTTTTGGGACGCGCTCCCACACCCGCCGAACAGCTTTCTCCCAAGTATGCAGGTCGAACCAGAGAATGTCACCGAGATCAACGGCGTTCGCATTGGCCCTGGAGGGTATGCCAAC
GTAAGCCGAAGAAGGATTGGCCGCACTCAAGTTCCTCCAAATTCCAAACCTGGAGCCGGCGCATCCACCACCCTTCCCGTCCCAGCTGCTCCCGCTCCGGTGCAGCAACTTCCCACGCCG
GCTCCTTCTGGCTTTGTCAATGGACCCGCAAAGCCTGCAAACGGTTCGACTGCTCCAGTCGACCCAACTCAGACCATCTCTCTTTCACCAGAAAATCGTATCCCGACAAAGGCCTATTCA
AGCCAGTTCCGTACGCCCTCTGGAGCGCAGAATAATCTCATCCTACCCCTCCTTGGTGCTGCAGGAAGTCCCTATGCACGCTCCGTCGTCCCTCAGCATCCAGTTCCTCATACGATTCTC
CCCGACCCAGGTCTCGTCTTTGACTTGCTCATGCGTCGAAGGGATCCTCCCTCGGCTGCCGTCAAGCCCGCTCCAGGAAAGCCCTCCAGGGATTATGACCCGCGCGTCGAAGCGCAATTC
CGCTCTCAGGGACACGGCCAGCGCCATCCAAGCGGGTTGAGCACCATGTTGTTCGCGTTTGGTGATTTGATCATCCACTCGTTGTTCCGCACTAGCAGCGACGACTCGAATGTCAACCTC
ACCAGCAGCTATCTCGATCTTAGCGTGCTCTATGGTGTTGACGAGGCGGAGATGCAGACCGTGAGGCGATATGATGGTACCGGTCGTATCTGGGAGGACTGCTGGGCAGACCCACGTCTT
TTTGGTATGCCTCCTGCCGTCTTGGCCGTCTTGATCGTCTTTTCAAGGAACCACAAC
TACGTTGCATTGAGACTGCTCGAGATCAACGAGGCACGTCAGTATACTTCACCGAGCATATCA
CCACCAAAGTCGAATCACGTTGGTGCCGACCAAATCTTCCCCACGCTCTCGGGTGATCCAGACAAACTGCGCGCGCAAGACGATGACATTTTCAACCGTGCAAGATTGATCAACTGTGCA
TTCTTCATGAACGTTATTCTTGGCGATTATCTCTCTGGTATCCTCGGTACCTTCCGCGAGGCGAGCGAATGGTGCCTCAACCCACTCGAGGAGATTCGCAAGGGTGGGAAGACGGCTTGT
CCTCGTGCAGAGGGCAACTGCGTCAGCGTCGAGTTTAACCTTCTCTATCGC
TGGCATGCTACCATGTCCCACAAGGACGTCGATTGGCTTGAGATGCTAGTCAAAAAGGCACTTCCTGGC
GAGGCTCGTATCCAATCTGCACCCCCCGGTCAACTTGAATTGTCAGAGGATGATTACAAGGCCGTTGCAGGCATGTTTGCCAAATTCCAAGCGGGAGCTGTTCGCGATCGCGTATTCGGA
GG
ATTGAAGCGTACGCCCGAAGGTGGCTTCGCGGACTCTGACCTCGCGCGTATCCTCCACGAAGCGACGGATACGGTTGCTTGTGCGTATGGTGCCAGGGGTATCCCATCCGTCATGAAG
GCTATCGAGGTCATGGGTATCAAGCAAGGTCGCAAGTGGGGTGTCTGCTCTCTCAACGAGTTCCGCAAATTTGTGGGACTCAAGCAATACGAGAGCTTTGAAGAGTGGAACCCGACGGGC
GATATCGCT
AAAGTCGCTAGGAATCTTTATCAGCACATTGACAACCTGGAACTCTATGTCGGTTTGATGTGCGAGGAATCAAAGAATCCTGGTCCAGGTGCTGGTCTTTGCCCTGGGTAC
ACCATTTCCCGTGCCATCCTAGCAGATGCAGTTTGCTTGACGCGAGGAGATCGATTCTTGACCACTGATCTTACGC
CGTTCAATTTGACATCATGGGGCTTCCAGGATTGCGCTCGAGAT
ACGAAGAATGGATCCCTTGGAGGCATGTTCAGCAAGCTTCTCTTCCGTACTCTCCCGGATCACTATCCGGCTAGCTCCATCTACGCACA
CTTCCCCTTCTTCACACCACCGGAGATGAAA
CACTGGCTTACAGAGATGAAGTTGATCCAGAACTATAACGTCGACAGGCCCTCTAGCGATCCCGTTCGCCCCACGCAGTCGATCAACTCTGCCCAGGGCATCGACCGTGTGCTCAAGGAC
ATGTCAACGTTCAACACAGTCTACGGGGACAGTATTCGCTACCTTAGCAACGGCTACGGATTCTTCCTTGCGTTTGACGAGGAGCCCAAGCATCGTGATGCTCGTCGTTTG
ATGCACGCT
GCGCTTTATCGCGATGGTGCGATGAAGAAATATGCCGAGTTTTACCAGAGAGAGGCGACTCGTCTCATCAGGTTGAGGTCGTTTGAGACTGGGCCCAAGTCGAGAGGCGTGAATATTGTT
CGTGATGTGATCAATATCGTCCCTGTGCACTGGGTGTCCGAGGAACTC
GCCGGACTTCCTCTCAAGTCGGAGGAAGCTCCACGGGGTCTGTTCACGGAGCAAGAGATGTATGGCATGTTT
GCCTGCGTTTTCAC
GTTCATTTTCTTGAACATTGAGCCGTCCAACGATTGGCCACTTCGCCAGAATTCCCTCAAGTTTTCCGAGATTATCACTGGATTCGTCAAAGCGCGTCTGCAAAAG
ATTGCTGGAGAGGGCTCTTTG
TTCTCTTTGCAGGGATTAAAGGACACGGTTCTCCAGTTCTTCACGGACAAAGTCGACAATAGTGACGAGTTTTATCGCACAATCCTCAACGGAAACAAC
GGCAAGTATACCATTGATCAGTTGGCTTCCAATGTCTTTGCCATGATCGTCGCCAGCGTTGCCAACTTTGCTCAGG
CGACCACCCACGTTGTGGACTTCTACTTGGACAAGGAGAGGGAG
GAAGAGTTCAAGCATCTCAAGGATCTCTCCATGGACAAGACTGCCGAGGCGGATGCTCTTCTCGCTGGTTATGCTCGCGAGGGACTTCGCTTCCGGCCACAGGCACCTGGTATCTTTAGA
CGTGCAACCAAGGACGTGACAGTGGTAGAAGGAAACGGCCTCAAGCCGGTTGATATCAAGGCTGGAGACCGCATCTTTGTCAGCCTTACGCATGCGGGCATGGAT
CCAAGCGTCTTCCCT
GATCCGACCAAGGTTGATCCTAGACGCCCGAGGGAAGCATACTACGCGTTTGGTCGTGGGGAGCATAC
TTGCCTCGGCGCCATGTTCACCGAAACGATGATCCCCGCAGTGCTTCGTGCC
GTCTTTAGTCTCCCCAACGTTCGCCGAGGACCGGGATATTCTGGAACGCTGAATAC
GTTCAAACACGACCTGTTTGGAACGGAGAGCCATCTGTACATCTCGAACAAGGGCACTGTAAGT
CCTTGGCCGGCGTTTATGATGATCGAG
TACGACGTCTAA

Retrieve as FASTA