Entry information : EcamPrx[P]03
Entry ID 10757
Creation 2012-03-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Achraf Jemmat
Last annotation changes 2016-03-23 (Achraf Jemmat)
Peroxidase information: EcamPrx[P]03
Name EcamPrx[P]03
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]03
start..stop
S start..stop
EgrPrx[P]03 260 3.97e-91 1..133 1..134
EgrPrx[P]14 260 5.41e-91 1..133 1..134
EglPrx[P]14 257 7.69e-90 1..133 1..134
EguPrx[P]14 255 3.98e-89 1..133 1..134
Gene structure Fichier Exons


exon

Literature and cross-references EcamPrx[P]03
Protein sequence: EcamPrx[P]03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   131
PWM (Da):   %s   14440.21  
PI (pH):   %s   6.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSCSVRHNVEAAATIKPP*KLQLLYYQNLCPDAKKYMWDHVEFYWKEDRTLAPSLI*LFYFDCFGCDALILFNGPDSKKTASQxAPLLALPMETIDKAKEVLEHHCPGVVSCADIINLA
ARDAVVLVCNMVC

Retrieve as FASTA  
Remarks Pseudogene from genomic (Exon 1 with stops in it). No prediction from kazusa.
DNA
Send to BLAST
CDS
Send to BLAST