Entry information : EcamPrx[P]117
Entry ID 10759
Creation 2012-03-15 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-03-15 (Qiang Li)
Peroxidase information: EcamPrx[P]117
Name EcamPrx[P]117
Class Class III peroxidase     [Orthogroup: Prx160]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]117
start..stop
S start..stop
EgrPrx117 444 2.96e-158 36..314 61..326
EguPrx117 439 1.83e-156 36..314 61..326
EglPrx117 434 1.41e-154 57..314 71..325
CpapPrx19 334 5.37e-115 36..314 58..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10759' 'join(1..429,484..516,550..640,737..1125)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..429 427 N° 2 484..516 31 N° 3 550..640 89 N° 4 737..1125 387
join(1..429,484..516,550..640,737..1125)


exon

Literature and cross-references EcamPrx[P]117
Protein sequence: EcamPrx[P]117
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   308 (237)
PWM (Da):   %s   33554.13 (25635.7)  
PI (pH):   %s   8.09 (6.99) Peptide Signal:   %s   cut: 23 range:23-259
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCSSFKVARAQHLVHCPKVIRN*I*KPELLLILM*RLLANILRTYS*RNTYYC*NAFDIALYKGCDGSLLLDDTPTFTGEKNAAPNVNSARGFEVVDQVKSAVEGVCPGIVSCADLLAII
ARDSVVIVSCLNLASN*YTINRDAMVASEAGKKREHPPATSDLNELISSFRNVGLNxRDLVALAGGHTIGLSRCTNFRDRVYNETNIDVLLAQTRKFGCPGIDGVDDDNLAPLDFQTPIT
FDHSYYSNLVQRRGLLHSDQQLFNGGPADSFVRLYSRSLLAFQGDFAASITRMGDIKPLTGSNGEIRRNCRRVN

Retrieve as FASTA  
Remarks Pseudogene from genomic. Stops in frame, incomplete. No prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTGTTCGTCGTTCAAAGTAGCAAGAGCTCAACATCTAGTCCATTGTCCCAAGGTCATAAGGAATTGAATATGAAAGCCTGAACTACTATTAATCTTAATGTAGCGCCTTTTAGCAAAC
ATACTGCGAACCTATAGCTGACGGAATACGTATTACTGTTGAAACGCATTTGATATCGCGTTGTATAAGGGCTGCGACGGATCGCTTCTTCTGGATGATACACCTACCTTCACTGGAGAG
AAAAACGCCGCTCCAAATGTCAATTCAGCGCGAGGGTTCGAAGTGGTCGACCAAGTTAAGTCCGCCGTGGAGGGGGTGTGTCCAGGCATCGTCTCGTGTGCTGATCTGTTGGCGATTATT
GCACGAGACTCCGTCGTGATCGTGAGCTGTTTGAATTTGGCTAGCAATTAATATACAATTAATAGAGAT
ATTTGGCGATGTTCTAATTTAGTTCCCTTGGACTATCATGCATGACAGCTT
GGAGGGCCATGGTGGCCAGTGAAGCTGGGAAGAAGAGAGATGCTAGAAGCGCAAGCCAAGCAGCTGCTAATGAGAGCATCCCCCGGCGACGTCCGACCTCAACGAATTAATCTCCTCGTT
CCGAAATGTCGGTCTCAACNTCAGGGACCTCGTGGCTTTAGCAG
AGGTAACTAAATTGTAATTTATCTCGCATAATCGAATCAGAAAGATGAGATCGAGAGCTCGTTCAATTTGATACAT
ATTTTTTTCGCGCCATTTCAAGGAGGCCACACGATCGGACTATCAAGATGCACGAACTTCAGGGACCGGGTCTACAACGAGACCAACATCGACGTGCTGTTGGCCCAAACGAGGAAGTTC
GGCTGCCCTGGCATCGACGGCGTGGACGACGACAATCTGGCCCCGCTCGACTTCCAGACCCCGATAACGTTCGACCACAGCTACTACTCCAACCTCGTCCAGAGGCGCGGCCTTCTCCAC
TCGGACCAGCAGCTCTTCAACGGCGGGCCCGCCGACTCGTTCGTGAGGCTCTATAGCAGAAGCCTGCTCGCCTTCCAGGGGGACTTCGCGGCCTCCATCACGAGGATGGGCGACATCAAG
CCCCTCACCGGATCCAACGGTGAGATTCGGAGGAACTGCAGGAGGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTGTTCGTCGTTCAAAGTAGCAAGAGCTCAACATCTAGTCCATTGTCCCAAGGTCATAAGGAATTGAATATGAAAGCCTGAACTACTATTAATCTTAATGTAGCGCCTTTTAGCAAAC
ATACTGCGAACCTATAGCTGACGGAATACGTATTACTGTTGAAACGCATTTGATATCGCGTTGTATAAGGGCTGCGACGGATCGCTTCTTCTGGATGATACACCTACCTTCACTGGAGAG
AAAAACGCCGCTCCAAATGTCAATTCAGCGCGAGGGTTCGAAGTGGTCGACCAAGTTAAGTCCGCCGTGGAGGGGGTGTGTCCAGGCATCGTCTCGTGTGCTGATCTGTTGGCGATTATT
GCACGAGACTCCGTCGTGATCGTGAGCTGTTTGAATTTGGCTAGCAATTAATATACAATTAATAGAGAT
GCCATGGTGGCCAGTGAAGCTGGGAAGAAGAGAGAGCATCCCCCGGCGACG
TCCGACCTCAACGAATTAATCTCCTCGTTCCGAAATGTCGGTCTCAACNTCAGGGACCTCGTGGCTTTAGCAG
GAGGCCACACGATCGGACTATCAAGATGCACGAACTTCAGGGACCGG
GTCTACAACGAGACCAACATCGACGTGCTGTTGGCCCAAACGAGGAAGTTCGGCTGCCCTGGCATCGACGGCGTGGACGACGACAATCTGGCCCCGCTCGACTTCCAGACCCCGATAACG
TTCGACCACAGCTACTACTCCAACCTCGTCCAGAGGCGCGGCCTTCTCCACTCGGACCAGCAGCTCTTCAACGGCGGGCCCGCCGACTCGTTCGTGAGGCTCTATAGCAGAAGCCTGCTC
GCCTTCCAGGGGGACTTCGCGGCCTCCATCACGAGGATGGGCGACATCAAGCCCCTCACCGGATCCAACGGTGAGATTCGGAGGAACTGCAGGAGGGTTAAT

Retrieve as FASTA