Entry information : OsPrx66(LOC_Os05g04410)
Entry ID 1076
Creation 2009-01-12 (Cyril Jourda)
Last sequence changes 2009-01-12 (Cyril Jourda)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: OsPrx66(LOC_Os05g04410)
Name OsPrx66(LOC_Os05g04410)
Class Class III peroxidase    [Orthogroup: Prx075]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Mixed tissues
Roots
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx66
start..stop
S start..stop
OsiPrx66 684 0 1..347 1..344
TaPrx57-1D 473 3.04e-169 42..349 31..339
TaPrx57-1B 473 5.68e-169 42..349 31..339
TaPrx151-2A 473 6.84e-169 42..347 31..337
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1076' 'join(1967471..1967695,1968571..1969395)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1967471..1967695 223 N° 2 1968571..1969395 823  
join(1967471..1967695,1968571..1969395)


exon

Literature and cross-references OsPrx66(LOC_Os05g04410)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q6AVZ7  A3AZP2 [Sequencing error]  Q5U1M7 [Sequencing error]
DNA ref. GenBank:   NC_008398.1 (1967471..1969392)
Cluster/Prediction ref. UniGene:   Os.11551
Protein sequence: OsPrx66(LOC_Os05g04410)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (319)
PWM (Da):   %s   36439.41 (33559.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.62 (5.20) Peptide Signal:   %s   cut: 31 range:31-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVMVKLNAAVAAAAVVLSLLVVVAVHPAAADAGGDWYGKKSIEET
VRKEVEKAIKHNPGVGAALVRLVFHDCWVN
GCDGSVLLDKTPYSSSTEKAAANNIGLDGFDVIDAIKSKLGAAVSCADIVVLAGRDASAILSGGRITYDVGTGRKDGVVSSAAAADAVLPESTFDFAQLKDNFASKGLTQGELVILSGAH
SIGVAHLSSFHDRLAAATATPIDATYASALAADVERQKGVQRTDNPAEKNNIRDMGAAFQSAAGYDAAGVDTAAVGALDNSYYHNNLQNRVLFKSDWVLRTDGDAAADLAEYRDNATKWD
VDFAAAMAKLSKLPAEGTHFEIRKTCRCTNQNYY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, intron 1) and 65 ESTs. Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATGGTGAAGCTTAACGCGGCGGTGGCCGCCGCCGCCGTTGTGCTGTCTCTGTTGGTGGTGGTCGCCGTGCATCCGGCGGCGGCCGACGCCGGCGGCGATTGGTACGGCAAGAAG
AGCATCGAGGAGACGGTGAGGAAGGAGGTGGAGAAGGCCATCAAGCACAATCCCGGCGTGGGTGCCGCCCTTGTCCGTTTGGTGTTCCATGACTGCTGGGTCAAC
ACGTAAGTATACTAA
CCACCATTTACTTTTTTTTTTCCGAGTACATGAATGACATACAGACACATACACATAGATCAGGATCCTCTGCAGTCGAAGTCACGTGTCTCTGTCACTGGCATGTGGATCCAATGATCC
CTGGACCCACATGTCAGTGACAAATATACCGTGTATTTTGATTGAAGAGGATCTCAATCCCACACGTAATATGTTACACATATTACATTTGCACGTACATATGTGCTTTAAATATATTGT
CTTTAATTAACACACTCTCAAAAAGATTTGGATCTGCTAAATGCATAAGTAAACCTGAAGTCCAATATGTATGCAGCTTAGCTTGCAATATAATGCAAATTTCGGTGGAGCTAGATAGGC
CTTATGGCATTTTTAGTTTGGCTTTTTTTTCTTTTGAATTGGGGATCATGTAAGAGAACTTGTCATGCTTGTCTGCATTAGCTTTTTTTTTTTTTTTGGGGGGGGGGGGTCTAAGTTGAT
AGTAAGTAGTAATAACTTTTCTTTTTTTTTTTCACCTGAAAATGATAATTAGATACCTTTTAAATTGTTGGATGATGTTGATGTGGTGCTTGAAAAGTGACTTGTAATGAGTTTGGAGAA
ATAACCACATGCATGAACAATACTATAACATGAATGGATATATAATAACAAAAAAAAAGCAGGGCTGTGATACCTTTTTAAATTGTGAGATGATGTTGATATGGTGTTTCAAAAGTGATT
CACTTACTGAGTTAATTTGGGCAAATAGCTAGCTTGATCTTAAAATATAACAATTTTTAACTATAAATTTGATTTGAATACATTTTTAAATTGTTAAGATGGAGCGCATAACTAATAAAG
AATTTTTTCTTGAAAAATGCAGGGTTGTGATGGATCGGTGCTCTTGGACAAGACGCCGTACAGCAGCAGCACGGAGAAGGCGGCGGCGAACAACATCGGCCTGGACGGCTTCGACGTCAT
CGACGCCATCAAATCCAAGCTGGGCGCCGCCGTCTCCTGCGCCGACATCGTGGTGCTCGCCGGCCGCGACGCCTCCGCCATCCTCAGCGGCGGCAGGATCACCTACGACGTCGGCACGGG
CCGCAAGGACGGCGTCGTCTCCTCCGCCGCCGCCGCCGACGCCGTCCTCCCGGAGTCCACCTTCGACTTCGCCCAGCTCAAGGACAACTTCGCCAGCAAGGGGCTCACCCAGGGGGAGCT
CGTCATCCTCTCCGGCGCCCACTCCATCGGCGTCGCCCACCTCTCCTCCTTCCACGACCGCCTCGCCGCCGCCACCGCCACGCCCATAGACGCCACGTACGCGTCGGCGCTCGCCGCCGA
CGTCGAACGGCAGAAGGGTGTCCAGCGCACGGACAACCCGGCGGAGAAGAACAACATCCGCGACATGGGCGCGGCGTTCCAGAGCGCCGCCGGGTACGACGCCGCCGGCGTGGACACGGC
GGCGGTGGGGGCGCTGGACAACAGCTACTACCACAACAACCTGCAGAACCGGGTGCTGTTCAAGTCGGACTGGGTGCTGCGCACCGACGGCGACGCCGCCGCCGACCTCGCCGAGTACAG
GGACAACGCCACCAAGTGGGACGTGGACTTCGCCGCCGCCATGGCCAAGCTCAGCAAGCTCCCCGCCGAGGGCACCCACTTCGAGATCAGGAAGACTTGCAGATGCACCAACCAGAACTA
CTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGATGGTGAAGCTTAACGCGGCGGTGGCCGCCGCCGCCGTTGTGCTGTCTCTGTTGGTGGTGGTCGCCGTGCATCCGGCGGCGGCCGACGCCGGCGGCGATTGGTACGGCAAGAAG
AGCATCGAGGAGACGGTGAGGAAGGAGGTGGAGAAGGCCATCAAGCACAATCCCGGCGTGGGTGCCGCCCTTGTCCGTTTGGTGTTCCATGACTGCTGGGTCAAC
GGTTGTGATGGATCG
GTGCTCTTGGACAAGACGCCGTACAGCAGCAGCACGGAGAAGGCGGCGGCGAACAACATCGGCCTGGACGGCTTCGACGTCATCGACGCCATCAAATCCAAGCTGGGCGCCGCCGTCTCC
TGCGCCGACATCGTGGTGCTCGCCGGCCGCGACGCCTCCGCCATCCTCAGCGGCGGCAGGATCACCTACGACGTCGGCACGGGCCGCAAGGACGGCGTCGTCTCCTCCGCCGCCGCCGCC
GACGCCGTCCTCCCGGAGTCCACCTTCGACTTCGCCCAGCTCAAGGACAACTTCGCCAGCAAGGGGCTCACCCAGGGGGAGCTCGTCATCCTCTCCGGCGCCCACTCCATCGGCGTCGCC
CACCTCTCCTCCTTCCACGACCGCCTCGCCGCCGCCACCGCCACGCCCATAGACGCCACGTACGCGTCGGCGCTCGCCGCCGACGTCGAACGGCAGAAGGGTGTCCAGCGCACGGACAAC
CCGGCGGAGAAGAACAACATCCGCGACATGGGCGCGGCGTTCCAGAGCGCCGCCGGGTACGACGCCGCCGGCGTGGACACGGCGGCGGTGGGGGCGCTGGACAACAGCTACTACCACAAC
AACCTGCAGAACCGGGTGCTGTTCAAGTCGGACTGGGTGCTGCGCACCGACGGCGACGCCGCCGCCGACCTCGCCGAGTACAGGGACAACGCCACCAAGTGGGACGTGGACTTCGCCGCC
GCCATGGCCAAGCTCAGCAAGCTCCCCGCCGAGGGCACCCACTTCGAGATCAGGAAGACTTGCAGATGCACCAACCAGAACTACTACTAG

Retrieve as FASTA