Entry information : DsMnP03 (MNP3 / MnP3-extralong)
Entry ID 10791
Creation 2012-03-02 (Catherine Mathe (Scipio))
Last sequence changes 2012-03-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Christophe Dunand)
Peroxidase information: DsMnP03 (MNP3 / MnP3-extralong)
Name (synonym) DsMnP03 (MNP3 / MnP3-extralong)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsMnP03
start..stop
S start..stop
DsMnP02 657 0 1..388 1..390
DsMnP04 641 0 1..389 1..391
DsMnP01 635 0 1..384 1..387
PrMnP02 606 0 1..389 1..390
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 582074..582202 129 N° 2 582261..582312 52 N° 3 582368..582394 27 N° 4 582446..582482 37
N° 5 582540..582717 178 N° 6 582782..583003 222 N° 7 583063..583477 415 N° 8 583544..583653 110
join(582074..582202,582261..582312,582368..582394,582446..582482,582540..582717, 582782..583003,583063..583477,583544..583653)


exon

Literature and cross-references DsMnP03 (MNP3 / MnP3-extralong)
DNA ref. JGI genome:   scaffold_12 (582074..583653)
Protein sequence: DsMnP03 (MNP3 / MnP3-extralong)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   389 (369)
PWM (Da):   %s   40500.02 (38513.9)  
PI (pH):   %s   4.09 (4.05) Peptide Signal:   %s   cut: 21 range:21-389
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKLLSIVSLVALATVASAAPSRTVCSDGTVVPDSVCCEFLPLAEALQTQVLMGDCGEDTHELLRLTFHDAIAISRSNASAGGGADGSMLIFPTVEPAFFANLGIADSVNNLIPFLSQFPSISAGDLVQFAGAVAITNCGAPQLEFLAGRPNATAPAIDGLIPEPQDNITKILARFDDAGGFTPFEVVSLLASHTIARADHVDPTLDAAPFDSTPFTFDTQIFLDVLLKGVGFPGLNNNTGEVSSPLPLSNGTDVGELRLQSDFGLAHDPRTACFWQGFVNEQEFMAQSFKAAMAKLAVLGHNADDLVDCSAVVPKPKLAVAVSAAFPATKGPDDLELSCNTSRFPNLPIDHGTQEALIPHCSDGSMSCTTVQFDGPALSFGDNNSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCAAGCTTTTGTCTATCGTCTCCCTCGTCGCTCTCGCCACTGTTGCCAGTGCCGCCCCGAGCCGGACGGTGTGCTCTGACGGGACTGTGGTCCCTGACTCGGTGTGCTGCGAA
TTTTTACCC
GTCAGTAATGGTTCCACCGCGCCGTCACATAATGGGGACTGATCATTCGGCAATACAGCTCGCAGAAGCTCTCCAGACGCAGGTCCTTATGGGCGACTGCGGAGAAGACAG
TATGTCATCTACTTGCGTTGCCGACGATCATGAACTGACCGGTCTTCATTCCAGCTCACGAGCTCCTCCGTCTCACATTCCGTAAGCCACACATCGGCTATACGTTCACGGCATACTGAC
CGTACATTGCAGACGATGCCATTGCCATCTCCCGCAGCAATGCTTCGGCGTGAGTCTTAATTCACGATTTTCTACAGATTTGGTGCTGACTATAGCTTGTGCGTAGTGGTGGTGGAGCCG
ACGGTTCGATGCTCATCTTCCCGACCGTCGAGCCTGCCTTCTTCGCTAACCTCGGTATCGCCGACTCCGTCAACAACCTCATCCCCTTCCTGTCGCAGTTCCCCAGCATCTCCGCCGGTG
ACCTCGTCCAGTTTGCAGGTGCTGTCGCCATCACCAACTGCCCT
GTATGCACATACTACTTTCCTCAGACTGCTCTTGTTCGAGTGCTCATACTTCGCGTTCCGACAGGGTGCACCGCAA
CTCGAGTTCCTTGCTGGTCGTCCCAATGCGACCGCCCCCGCCATCGATGGTCTGATTCCCGAGCCCCAGGACAATATTACGAAGATTCTGGCGCGGTTCGACGATGCCGGAGGGTTCACG
CCGTTCGAGGTCGTCTCCCTTCTCGCTTCGCACACGATCGCTCGTGCCGACCATGTCGACCCGACTCTCGACGCCGCGCCCTTCGACAGT
GTAAGTTGCGCCCCCTCCCTCGTTCACAGC
GCCCGCTCACCAGAACCCCCGTGCCACAGACTCCCTTCACCTTCGACACCCAGATCTTCCTCGATGTGCTCCTCAAGGGTGTCGGCTTCCCTGGGCTGAACAACAACACTGGCGAGGTCT
CCTCCCCGCTCCCCCTTTCGAACGGCACCGACGTCGGCGAGCTCCGTCTCCAGTCCGACTTCGGCCTCGCCCACGACCCGCGCACGGCTTGCTTCTGGCAGGGCTTCGTCAATGAGCAGG
AGTTCATGGCGCAGTCGTTCAAGGCCGCGATGGCGAAGCTCGCTGTGCTCGGCCACAACGCGGACGACCTCGTCGACTGTTCTGCTGTCGTACCGAAGCCTAAGCTCGCGGTTGCCGTGT
CCGCGGCGTTCCCGGCGACCAAGGGCCCGGACGACCTCGAGCTGTCGTGCAACACCTCGCGGTTCCCCAACCTGCCTATCGATC
GTGAGTCGCTTTCTTTAGTCCGTGGATCTGTTAGTC
AAATAAGCTGAACGCAACCGTGTTTTCCAGATGGCACCCAGGAGGCCCTCATCCCGCACTGCTCGGACGGCAGCATGAGCTGCACCACCGTTCAGTTCGACGGCCCGGCGCTCAGCTTCG
GTGACAATAACAGCTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCAAGCTTTTGTCTATCGTCTCCCTCGTCGCTCTCGCCACTGTTGCCAGTGCCGCCCCGAGCCGGACGGTGTGCTCTGACGGGACTGTGGTCCCTGACTCGGTGTGCTGCGAA
TTTTTACCC
CTCGCAGAAGCTCTCCAGACGCAGGTCCTTATGGGCGACTGCGGAGAAGACACTCACGAGCTCCTCCGTCTCACATTCCACGATGCCATTGCCATCTCCCGCAGCAATGCT
TCGGC
TGGTGGTGGAGCCGACGGTTCGATGCTCATCTTCCCGACCGTCGAGCCTGCCTTCTTCGCTAACCTCGGTATCGCCGACTCCGTCAACAACCTCATCCCCTTCCTGTCGCAGTTC
CCCAGCATCTCCGCCGGTGACCTCGTCCAGTTTGCAGGTGCTGTCGCCATCACCAACTGCCCT
GGTGCACCGCAACTCGAGTTCCTTGCTGGTCGTCCCAATGCGACCGCCCCCGCCATC
GATGGTCTGATTCCCGAGCCCCAGGACAATATTACGAAGATTCTGGCGCGGTTCGACGATGCCGGAGGGTTCACGCCGTTCGAGGTCGTCTCCCTTCTCGCTTCGCACACGATCGCTCGT
GCCGACCATGTCGACCCGACTCTCGACGCCGCGCCCTTCGACAGT
ACTCCCTTCACCTTCGACACCCAGATCTTCCTCGATGTGCTCCTCAAGGGTGTCGGCTTCCCTGGGCTGAACAAC
AACACTGGCGAGGTCTCCTCCCCGCTCCCCCTTTCGAACGGCACCGACGTCGGCGAGCTCCGTCTCCAGTCCGACTTCGGCCTCGCCCACGACCCGCGCACGGCTTGCTTCTGGCAGGGC
TTCGTCAATGAGCAGGAGTTCATGGCGCAGTCGTTCAAGGCCGCGATGGCGAAGCTCGCTGTGCTCGGCCACAACGCGGACGACCTCGTCGACTGTTCTGCTGTCGTACCGAAGCCTAAG
CTCGCGGTTGCCGTGTCCGCGGCGTTCCCGGCGACCAAGGGCCCGGACGACCTCGAGCTGTCGTGCAACACCTCGCGGTTCCCCAACCTGCCTATCGATC
ATGGCACCCAGGAGGCCCTC
ATCCCGCACTGCTCGGACGGCAGCATGAGCTGCACCACCGTTCAGTTCGACGGCCCGGCGCTCAGCTTCGGTGACAATAACAGCTCTTGA

Retrieve as FASTA