Entry information : DsMnP04 (MNP4 / MnP4-extralong)
Entry ID 10792
Creation 2012-03-27 (Christophe Dunand)
Last sequence changes 2012-03-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Christophe Dunand)
Peroxidase information: DsMnP04 (MNP4 / MnP4-extralong)
Name (synonym) DsMnP04 (MNP4 / MnP4-extralong)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsMnP04
start..stop
S start..stop
DsMnP03 681 0 1..391 1..389
DsMnP02 673 0 1..389 1..389
DsMnP01 659 0 1..387 1..388
PrMnP02 622 0 1..391 1..390
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 617966..618097 132 N° 2 618156..618207 52 N° 3 618263..618289 27 N° 4 618343..618382 40
N° 5 618443..618620 178 N° 6 618685..618906 222 N° 7 618967..619381 415 N° 8 619448..619557 110
join(617966..618097,618156..618207,618263..618289,618343..618382,618443..618620, 618685..618906,618967..619381,619448..619557)


exon

Literature and cross-references DsMnP04 (MNP4 / MnP4-extralong)
DNA ref. JGI genome:   scaffold_12 (617966..619557)
Cluster/Prediction ref. JGI gene:   169849
Protein sequence: DsMnP04 (MNP4 / MnP4-extralong)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   392 (371)
PWM (Da):   %s   40873 (38756.8)  
PI (pH):   %s   4.02 (4.01) Peptide Signal:   %s   cut: 21 range:21-391
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKLWSIVSLVALAAVASAAPSRRTVCSDGTVVPDSVCCEFIPLAEALQTQVLMGDCGEDAHELLRLTFHDAIAISRSQGRAAGGGADGSMLIFPTVEPAFFANLGIADSVNNLIPFLSQFPKISAGDLVQFAGAVAITNCPGAPQLEFLAGRPNATAPAVDGLIPEPQDSITDILNRFDDAGGFTPFEVVSLLASHTVARADHVDPTLDAAPFDSTPFTFDTQIFLDVLLKGTGFPGLGNNTGEVSSPLPLTNGTDVGELRLQSDFGLAHDERTACFWQGFVDKQDFMASSFKAAMAKLAVLGHNTNDLVDCSAVVPQPKPAVVPSAAFPATKSAADLELSCNSERFPTLTTDPGTQETLIPHCSDGSMDCESVQFDGPATNFGGDDDS*

Retrieve as FASTA  
Remarks Complete sequence from genomic ( introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCAAGCTCTGGTCTATCGTCTCCCTCGTCGCGCTCGCCGCCGTCGCGAGTGCTGCCCCGAGTCGCCGGACGGTGTGCTCTGACGGCACCGTCGTCCCTGACTCGGTGTGCTGC
GAGTTCATCCCC
GTTAGTTCCGATTCCTCCGTGCCGTCACATACTAAGAACTAATCCTTCTGCAACACAGCTCGCAGAAGCTCTCCAGACGCAGGTCCTTATGGGCGACTGTGGCGAGGA
TG
GTATGCTATCTACGTGCGACGCCTATAACCGCAAACTGACCGCTATTCATCCCAGCTCACGAGCTCCTCCGTCTCACTTTCCGTAAGCCGTCTGCATGAGCCGTGTCACAGCGACATA
CTGATCATACATTACAGACGACGCGATCGCTATCTCTCGCAGCCAGGGTCGCGCTGCGTAAGTAACGGGACTGTGAATTCTGCGAGCGTTCTGATGCTTACTACGTTTTGTGTGCAGTGG
TGGAGGAGCCGATGGTTCGATGCTCATCTTCCCGACCGTCGAGCCTGCCTTCTTCGCCAACCTCGGTATCGCCGACTCCGTCAACAACCTCATCCCCTTCCTGTCGCAGTTCCCCAAGAT
CTCCGCCGGCGACCTCGTCCAGTTCGCAGGTGCTGTCGCCATCACTAACTGCCCT
GTACGCACATACTACTTTCCTCAGACTGCCCGTGATCTCGTGCTGATATCTCGCGTTCCGATAGG
GTGCTCCGCAACTCGAGTTCCTTGCTGGTCGCCCTAACGCGACCGCCCCTGCCGTCGACGGTCTGATCCCCGAACCGCAGGACAGCATCACGGACATTCTGAACCGGTTCGACGATGCAG
GAGGGTTCACGCCGTTCGAGGTCGTCTCCCTTCTCGCTTCCCACACGGTCGCTCGTGCCGATCACGTCGACCCCACTCTCGACGCCGCGCCTTTCGACAGC
GTGAGCATCGCACCACAAC
TTATTCACAATGCTTGCTGACCTAGCTTCCTTGTGAAACAGACGCCCTTCACCTTCGACACGCAGATCTTCCTTGACGTGCTCCTCAAGGGTACCGGCTTCCCCGGTCTGGGCAACAACA
CCGGCGAGGTCTCCTCACCGCTCCCCCTGACGAACGGCACCGACGTCGGCGAGCTCCGTCTCCAGTCCGACTTTGGCCTCGCCCACGACGAGCGCACGGCCTGCTTCTGGCAGGGCTTCG
TTGACAAGCAGGACTTCATGGCGTCGTCCTTCAAGGCTGCCATGGCCAAGCTCGCCGTCCTCGGCCACAACACTAACGACCTGGTCGACTGCTCCGCTGTCGTACCCCAGCCGAAGCCCG
CCGTTGTGCCGTCCGCGGCGTTCCCGGCCACCAAGAGCGCGGCGGATCTCGAGCTGTCGTGCAACAGCGAGCGGTTCCCCACCCTCACCACTGACC
GTGAGTATCTTTGCCTCGCCCGTC
GTACTGTACATAATAATAGCTGAATATGATCCCTTCTTGCAGCCGGCACCCAGGAGACTCTGATCCCGCACTGCTCGGACGGCAGCATGGATTGCGAGAGTGTCCAGTTCGACGGCCCGG
CGACCAACTTCGGTGGTGACGATGACTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTCAAGCTCTGGTCTATCGTCTCCCTCGTCGCGCTCGCCGCCGTCGCGAGTGCTGCCCCGAGTCGCCGGACGGTGTGCTCTGACGGCACCGTCGTCCCTGACTCGGTGTGCTGC
GAGTTCATCCCC
CTCGCAGAAGCTCTCCAGACGCAGGTCCTTATGGGCGACTGTGGCGAGGATGCTCACGAGCTCCTCCGTCTCACTTTCCACGACGCGATCGCTATCTCTCGCAGCCAG
GGTCGCGCTGC
TGGTGGAGGAGCCGATGGTTCGATGCTCATCTTCCCGACCGTCGAGCCTGCCTTCTTCGCCAACCTCGGTATCGCCGACTCCGTCAACAACCTCATCCCCTTCCTGTCG
CAGTTCCCCAAGATCTCCGCCGGCGACCTCGTCCAGTTCGCAGGTGCTGTCGCCATCACTAACTGCCCT
GGTGCTCCGCAACTCGAGTTCCTTGCTGGTCGCCCTAACGCGACCGCCCCT
GCCGTCGACGGTCTGATCCCCGAACCGCAGGACAGCATCACGGACATTCTGAACCGGTTCGACGATGCAGGAGGGTTCACGCCGTTCGAGGTCGTCTCCCTTCTCGCTTCCCACACGGTC
GCTCGTGCCGATCACGTCGACCCCACTCTCGACGCCGCGCCTTTCGACAGC
ACGCCCTTCACCTTCGACACGCAGATCTTCCTTGACGTGCTCCTCAAGGGTACCGGCTTCCCCGGTCTG
GGCAACAACACCGGCGAGGTCTCCTCACCGCTCCCCCTGACGAACGGCACCGACGTCGGCGAGCTCCGTCTCCAGTCCGACTTTGGCCTCGCCCACGACGAGCGCACGGCCTGCTTCTGG
CAGGGCTTCGTTGACAAGCAGGACTTCATGGCGTCGTCCTTCAAGGCTGCCATGGCCAAGCTCGCCGTCCTCGGCCACAACACTAACGACCTGGTCGACTGCTCCGCTGTCGTACCCCAG
CCGAAGCCCGCCGTTGTGCCGTCCGCGGCGTTCCCGGCCACCAAGAGCGCGGCGGATCTCGAGCTGTCGTGCAACAGCGAGCGGTTCCCCACCCTCACCACTGACC
CCGGCACCCAGGAG
ACTCTGATCCCGCACTGCTCGGACGGCAGCATGGATTGCGAGAGTGTCCAGTTCGACGGCCCGGCGACCAACTTCGGTGGTGACGATGACTCGTAG

Retrieve as FASTA