Entry information : PgigMnP04 (MnP-long)
Entry ID 10794
Creation 2012-03-28 (Christophe Dunand)
Last sequence changes 2012-03-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Christophe Dunand)
Peroxidase information: PgigMnP04 (MnP-long)
Name (synonym) PgigMnP04 (MnP-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigMnP04
start..stop
S start..stop
CsuMnP02 630 0 1..388 1..382
CsuMnP10 609 0 1..388 1..378
PgigMnP05 608 0 1..388 1..381
CsuMnP05 600 0 1..388 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 121002..121121 120 N° 2 121177..121228 52 N° 3 121284..121310 27 N° 4 121366..121405 40
N° 5 121457..121634 178 N° 6 121697..121918 222 N° 7 121971..122415 445 N° 8 122474..122568 95
join(121002..121121,121177..121228,121284..121310,121366..121405,121457..121634, 121697..121918,121971..122415,122474..122568)


exon

Literature and cross-references PgigMnP04 (MnP-long)
DNA ref. JGI genome:   scaffold_19 (121002..122568)
Cluster/Prediction ref. JGI gene:   65970 [Incorrect prediction]
Protein sequence: PgigMnP04 (MnP-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   392 (374)
PWM (Da):   %s   40929.45 (39116.5)  
PI (pH):   %s   4.65 (4.65) Peptide Signal:   %s   cut: 19 range:19-392
Sequence 433
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFSSLVAFVALATFASAAPSKTCPDGTRVSNTACCAFIPLAQDLQTNVFQSQCGEDAHEALRLTFHDAIAISRSKGPSAGGGADGSMLLFPTVEPAFHANAGIDDSVNNLIPFLAKHPTISAGDLVQFAGAVAISNCPGAPQLEFLAGRPNKTIPAIDGLIPVPEDTVTAIIDRFADAGGFTPFEIISLLASHSIARADKVDLSIDAAPFDSTPFTFDTQIYLEVLLKGVGFPGNGSVINGNVGEVASPLPLGDVKSTPKGNDTGELRLQSDFALARDPRTACFWQGFVNEQQFMMSSFKAAMSKLAVLGHNRNDLIDCSEVVPAPKPPVNKPASFPATTGPQDLQLTCKTERFPSLTIDHGAKETLIPHCPSGGEDCPSIQFSGPATSNP

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). Incorrect prediction from JGI (fusion of two tandem genes).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTTTTCTCTTCGCTTGTCGCCTTCGTAGCCCTTGCTACCTTCGCTAGTGCCGCACCGTCCAAGACCTGCCCGGACGGTACTCGCGTCAGCAACACCGCCTGCTGTGCTTTCATTCCTG
TATGCCGTCTTCACTCGCCGTCGATTTGACGAGAACTGACCAGACGGCGGGCAGCTTGCACAGGACCTGCAGACCAACGTGTTCCAGAGCCAATGTGGCGAGGATGGTATGCTTTGTGCC
GTACTATTCGTCGCCTCTCGCCGCTAATAATTTCCCCCCAGCCCATGAGGCCCTTCGTCTGACCTTCCGTTCGTCCCTAGTCATTGTATAACCTCGAAATCTACTGACTACTTTCTTTGA
CAGATGACGCCATCGCCATCTCGAGGAGCAAAGGGCCTTCCGCGTAAGTAGGCATCGTGACAGAGTAGAACGTCGAGCTCATAACATGTTTCAGTGGTGGAGGAGCAGATGGATCAATGC
TCCTGTTCCCGACCGTGGAACCAGCCTTCCACGCGAACGCCGGCATAGACGACAGTGTTAACAACCTTATCCCCTTCCTGGCCAAGCATCCGACGATCAGCGCCGGTGATCTCGTCCAGT
TTGCGGGGGCTGTCGCTATCAGCAACTGTCCG
GTTAGTTGTCAGCTGTCTATCCGTAGCTGATGCGTCTCGCTCACACCCTTCATACGACACAGGGTGCCCCCCAGCTTGAGTTCCTCGC
GGGTCGCCCGAACAAGACCATCCCCGCTATCGACGGCCTGATCCCCGTCCCAGAGGACACTGTGACTGCCATTATTGACCGCTTTGCCGATGCTGGAGGTTTCACGCCTTTCGAGATCAT
CTCGCTCTTGGCTTCGCACTCCATTGCCCGTGCTGACAAGGTTGACTTGAGCATTGACGCTGCTCCCTTCGACTCT
GTGAGCAGGTTCATGTCTAGCATATGTCTCTCAAGCTTACGCTA
TCACACAGACCCCGTTCACTTTCGACACCCAGATCTACCTTGAGGTGCTGCTCAAGGGCGTCGGCTTCCCCGGCAACGGTAGCGTGATCAATGGAAATGTCGGGGAGGTTGCTTCTCCCC
TTCCGCTCGGCGACGTCAAGAGCACCCCGAAGGGTAACGACACGGGAGAGTTGCGCCTACAGTCCGACTTTGCACTTGCACGTGACCCGCGCACGGCGTGCTTCTGGCAGGGTTTCGTGA
ACGAGCAGCAGTTCATGATGAGCAGCTTCAAGGCGGCGATGTCCAAGCTAGCCGTTCTCGGCCACAACCGCAACGATCTCATCGACTGCTCCGAGGTTGTTCCCGCTCCTAAGCCCCCGG
TCAACAAGCCCGCATCGTTCCCCGCCACTACCGGCCCCCAGGATCTCCAGCTGACCTGCAAGACGGAGCGGTTCCCCAGCCTCACCATTGATC
GTGAGTGTTCCGCCGCGTGCTGTTCCA
GCGTTAGCAAGATCACTGACATGGTTATTAGACGGTGCCAAGGAGACCCTCATTCCTCACTGTCCAAGCGGCGGCGAGGACTGCCCATCTATCCAGTTCTCGGGCCCTGCGACGAGCAAC
CCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTTTTCTCTTCGCTTGTCGCCTTCGTAGCCCTTGCTACCTTCGCTAGTGCCGCACCGTCCAAGACCTGCCCGGACGGTACTCGCGTCAGCAACACCGCCTGCTGTGCTTTCATTCCTC
TTGCACAGGACCTGCAGACCAACGTGTTCCAGAGCCAATGTGGCGAGGATG
CCCATGAGGCCCTTCGTCTGACCTTCCATGACGCCATCGCCATCTCGAGGAGCAAAGGGCCTTCCGCTG
GTGGAGGAGCAGATGGATCAATGCTCCTGTTCCCGACCGTGGAACCAGCCTTCCACGCGAACGCCGGCATAGACGACAGTGTTAACAACCTTATCCCCTTCCTGGCCAAGCATCCGACGA
TCAGCGCCGGTGATCTCGTCCAGTTTGCGGGGGCTGTCGCTATCAGCAACTGTCCG
GGTGCCCCCCAGCTTGAGTTCCTCGCGGGTCGCCCGAACAAGACCATCCCCGCTATCGACGGCC
TGATCCCCGTCCCAGAGGACACTGTGACTGCCATTATTGACCGCTTTGCCGATGCTGGAGGTTTCACGCCTTTCGAGATCATCTCGCTCTTGGCTTCGCACTCCATTGCCCGTGCTGACA
AGGTTGACTTGAGCATTGACGCTGCTCCCTTCGACTCT
ACCCCGTTCACTTTCGACACCCAGATCTACCTTGAGGTGCTGCTCAAGGGCGTCGGCTTCCCCGGCAACGGTAGCGTGATCA
ATGGAAATGTCGGGGAGGTTGCTTCTCCCCTTCCGCTCGGCGACGTCAAGAGCACCCCGAAGGGTAACGACACGGGAGAGTTGCGCCTACAGTCCGACTTTGCACTTGCACGTGACCCGC
GCACGGCGTGCTTCTGGCAGGGTTTCGTGAACGAGCAGCAGTTCATGATGAGCAGCTTCAAGGCGGCGATGTCCAAGCTAGCCGTTCTCGGCCACAACCGCAACGATCTCATCGACTGCT
CCGAGGTTGTTCCCGCTCCTAAGCCCCCGGTCAACAAGCCCGCATCGTTCCCCGCCACTACCGGCCCCCAGGATCTCCAGCTGACCTGCAAGACGGAGCGGTTCCCCAGCCTCACCATTG
ATC
ACGGTGCCAAGGAGACCCTCATTCCTCACTGTCCAAGCGGCGGCGAGGACTGCCCATCTATCCAGTTCTCGGGCCCTGCGACGAGCAACCCCTAA

Retrieve as FASTA