Entry information : PgigMnP03 (MnP-long)
Entry ID 10795
Creation 2012-03-28 (Christophe Dunand)
Last sequence changes 2012-03-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Christophe Dunand)
Peroxidase information: PgigMnP03 (MnP-long)
Name (synonym) PgigMnP03 (MnP-long)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Phanerochaetaceae Phlebiopsis
Organism Phlebiopsis gigantea    [TaxId: 82310 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PgigMnP03
start..stop
S start..stop
CsuMnP05 642 0 1..380 1..377
CsuMnP10 628 0 1..380 1..378
PgigMnP02 622 0 1..384 1..388
PbreMnP04 621 0 1..383 1..383
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 61133..61261 129 N° 2 61325..61403 79 N° 3 61458..61497 40 N° 4 61550..61724 175
N° 5 61779..62000 222 N° 6 62051..62465 415 N° 7 62519..62613 95  
join(61133..61261,61325..61403,61458..61497,61550..61724,61779..62000,62051..624 65,62519..62613)


exon

Literature and cross-references PgigMnP03 (MnP-long)
DNA ref. JGI genome:   scaffold_130 (59510..62613)
Cluster/Prediction ref. JGI gene:   75606 [Incorrect prediction]
Protein sequence: PgigMnP03 (MnP-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   384 (366)
PWM (Da):   %s   39861.76 (38061.7)  
PI (pH):   %s   4.27 (4.22) Peptide Signal:   %s   cut: 19 range:19-384
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLLSLVALAAIARAAPAAENAVCSDGTRVSNSACCAFIPLAQDLQTNVFQNQCGEDAHEVIRLIFHDAIAISQSQGPSAGGGADGSMLLFPTVEPLFGPNNGIDDSVNNLIPFLAKHPVSAADLVQFAGAVALSNCGAPRVEFLAGRPNHTIPAIDGLIPDPADDVTKILARFDDAGGFTPFEVVSLLASHSIARADKVDETIDAAPFDSTPFTFDTQIFLEVMLKGVGFPGAANNSGEVSSPLPLGSGNDTGEMRLQSDFALARDSRTACFWQGFVNEQEFMTASFGAAVAKLAILGHNRNDLIDCSSVVPVPKPAVNKPASFPATTSAKDLDLVCTTQKFPTLTVDKGATQSLIPHCVDGSQDCPAIQFDGPAQASS

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Incorrect prediction from JGI (fusion of two tandem duplicated genes).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCACATCTCTTCTCTCCCTCGTCGCCCTCGCCGCAATTGCCCGTGCTGCACCCGCCGCCGAGAACGCTGTCTGTTCCGACGGCACTCGTGTCAGCAACTCAGCTTGCTGCGCT
TTTATTCCC
GTTCGTCTCCCTTCCCTTTGGATGTTTGATTTTCCAAACTTATCAGATATTCTCTGTCGCCAGCTTGCGCAGGATCTTCAGACTAACGTATTCCAAAACCAATGTGGTGAG
GATGCACACGAGGTCATCCGTCTCATTTTCC
GTTCGTATTTTTGCGCTCGCAGTTCTTCACGAGATAGCTCACGAGCCCGCCTAGACGACGCGATAGCAATTTCTCAAAGTCAGGGTCCT
TCTGC
GTAAGTAAAGCATGACTAGTCTTAGTCAATTGACACTCACCATTGACCATAGTGGTGGAGGAGCTGACGGCTCGATGCTCCTGTTCCCTACCGTTGAGCCGCTTTTCGGCCCTAA
CAACGGTATCGACGACTCGGTCAATAACCTCATTCCGTTCTTGGCCAAGCACCCCGTCTCCGCTGCTGACCTCGTCCAGTTCGCTGGCGCAGTCGCTCTCAGCAACTGTCCT
GTAAGTTC
TAGTGAAACGAGACTTGAACATGATCTTAATGCCGGTCTGTTACAGGGCGCACCCCGTGTTGAGTTCTTGGCGGGTCGCCCCAACCACACTATCCCTGCTATCGACGGCTTGATTCCTGA
TCCTGCGGACGACGTCACCAAGATCCTCGCACGGTTCGACGACGCTGGAGGATTTACTCCCTTTGAAGTCGTCTCTCTCCTTGCATCGCACTCTATTGCCCGCGCTGACAAGGTTGATGA
GACAATCGATGCCGCCCCCTTTGACTCT
GTAAGTATATGTGTCTTAATCCCCTATCTTCGAGACTCACTTCGCCCTAGACCCCTTTTACTTTCGACACCCAGATCTTCCTCGAGGTCATG
CTTAAGGGCGTAGGCTTCCCCGGTGCGGCCAACAACAGCGGCGAGGTCTCCTCTCCCCTGCCCTTGGGCAGTGGCAACGACACCGGCGAGATGCGTCTCCAGTCAGACTTCGCCCTCGCC
CGCGACTCGCGTACCGCCTGCTTCTGGCAGGGCTTCGTCAACGAGCAGGAGTTCATGACCGCCAGCTTCGGCGCTGCCGTCGCCAAACTCGCCATCCTCGGCCACAACCGCAACGACCTG
ATTGACTGCTCCTCGGTTGTCCCGGTCCCGAAGCCTGCCGTCAACAAGCCCGCGAGCTTCCCGGCCACCACCAGTGCCAAGGACCTTGACCTTGTCTGCACGACACAGAAGTTCCCAACT
CTCACTGTCGATA
GTATGTCCTTTCACGCGTCTCACTGGACTATACCAAACTAACGCCCTTTGTAGAGGGTGCTACCCAGAGCCTCATCCCTCACTGCGTGGACGGCAGTCAGGACTGCC
CTGCTATTCAGTTCGACGGCCCCGCCCAAGCCTCGTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCACATCTCTTCTCTCCCTCGTCGCCCTCGCCGCAATTGCCCGTGCTGCACCCGCCGCCGAGAACGCTGTCTGTTCCGACGGCACTCGTGTCAGCAACTCAGCTTGCTGCGCT
TTTATTCCC
CTTGCGCAGGATCTTCAGACTAACGTATTCCAAAACCAATGTGGTGAGGATGCACACGAGGTCATCCGTCTCATTTTCCACGACGCGATAGCAATTTCTCAAAGTCAGGGT
CCTTCTGC
TGGTGGAGGAGCTGACGGCTCGATGCTCCTGTTCCCTACCGTTGAGCCGCTTTTCGGCCCTAACAACGGTATCGACGACTCGGTCAATAACCTCATTCCGTTCTTGGCCAAG
CACCCCGTCTCCGCTGCTGACCTCGTCCAGTTCGCTGGCGCAGTCGCTCTCAGCAACTGTCCT
GGCGCACCCCGTGTTGAGTTCTTGGCGGGTCGCCCCAACCACACTATCCCTGCTATC
GACGGCTTGATTCCTGATCCTGCGGACGACGTCACCAAGATCCTCGCACGGTTCGACGACGCTGGAGGATTTACTCCCTTTGAAGTCGTCTCTCTCCTTGCATCGCACTCTATTGCCCGC
GCTGACAAGGTTGATGAGACAATCGATGCCGCCCCCTTTGACTCT
ACCCCTTTTACTTTCGACACCCAGATCTTCCTCGAGGTCATGCTTAAGGGCGTAGGCTTCCCCGGTGCGGCCAAC
AACAGCGGCGAGGTCTCCTCTCCCCTGCCCTTGGGCAGTGGCAACGACACCGGCGAGATGCGTCTCCAGTCAGACTTCGCCCTCGCCCGCGACTCGCGTACCGCCTGCTTCTGGCAGGGC
TTCGTCAACGAGCAGGAGTTCATGACCGCCAGCTTCGGCGCTGCCGTCGCCAAACTCGCCATCCTCGGCCACAACCGCAACGACCTGATTGACTGCTCCTCGGTTGTCCCGGTCCCGAAG
CCTGCCGTCAACAAGCCCGCGAGCTTCCCGGCCACCACCAGTGCCAAGGACCTTGACCTTGTCTGCACGACACAGAAGTTCCCAACTCTCACTGTCGATA
AGGGTGCTACCCAGAGCCTC
ATCCCTCACTGCGTGGACGGCAGTCAGGACTGCCCTGCTATTCAGTTCGACGGCCCCGCCCAAGCCTCGTCTTGA

Retrieve as FASTA