Entry information : PcarMnP05
Entry ID 10796
Creation 2012-03-29 (Christophe Dunand)
Last sequence changes 2012-03-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarMnP05
Name PcarMnP05
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarMnP05
start..stop
S start..stop
PcarMnP06 651 0 1..380 1..380
PcarMnP07 640 0 1..385 1..385
PcarMnP01 634 0 1..385 1..385
PbreMnP05 602 0 27..385 24..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3208808..3208942 135 N° 2 3209000..3209051 52 N° 3 3209106..3209132 27 N° 4 3209188..3209227 40
N° 5 3209285..3209462 178 N° 6 3209525..3209746 222 N° 7 3209797..3210211 415 N° 8 3210275..3210366 92
join(3208808..3208942,3209000..3209051,3209106..3209132,3209188..3209227,3209285 ..3209462,3209525..3209746,3209797..3210211,3210275..3210366)


exon

Literature and cross-references PcarMnP05
DNA ref. JGI genome:   scaffold_5 (3208808..3210366)
Cluster/Prediction ref. JGI gene:   94399
Protein sequence: PcarMnP05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   387 (369)
PWM (Da):   %s   40645.97 (38755.9)  
PI (pH):   %s   4.08 (4.07) Peptide Signal:   %s   cut: 18 range:18-386
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MILKFSSLIALVAVAVAVHTASASIAATCSDGTQVPDKMCCNFIPLISALQNTLFMEECGEDAHEVIRLTFHDAIAISQSQGPAAGGGADGSMLIFPTVEPSFAANVGINDSVDSLTPFMSQFPSITAADLVQFAGAVALSNCPGAPQLEFLAGRPNATAPAVEGLIPEPQDNITSILDRFADAGSFSPFEVVSLLASHSIARADKVDPTIDAAPFDSTPFVFDTQVFLEVLLRGVGFPGTDNNTGEVESPLPLTVGSDTGEMRLQSDFALARDPRTACFWQGFVNQQEFMASSFKAAMSKLAILGHNRADLVDCSAVVPVPKPAVNKPASFPATTGPQDLELSCTTEKFPTLTVDDGAYETVIPHCPDGSMTCNDVRFRVQAVDY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCTCAAATTCTCTTCACTCATCGCCCTCGTCGCCGTTGCTGTGGCCGTGCACACTGCTTCAGCCTCCATCGCTGCCACCTGCTCCGACGGCACACAGGTCCCCGACAAGATGTGC
TGCAACTTCATCCCT
GTGCGTCTACTCCATTTTGTACGGCGCTACAGCTGTGGCTGAAACACTTGAATGTAGCTCATATCAGCGCTCCAGAATACTTTGTTCATGGAAGAATGCGGTGAA
GATG
GTAGGTCATTTGTCTTCTTCGATTTGTGATGATGGCGCTGACGTCTCATCCAAGCTCACGAGGTCATTCGTCTAACTTTCCGTAAGTGAAACTCTGTCGAGGGTAGCTAGCAGTAA
GCTTATTGTTATGTTGTCAGATGATGCCATTGCTATCTCTCAGAGCCAGGGTCCCGCGGCGTGAGTTGCTCTACGTCTTGATCAGTGGTCGGAAGTATACTGACCCTGGGTGTGCAGCGG
TGGAGGAGCCGACGGGTCGATGCTCATCTTCCCGACCGTCGAGCCATCGTTCGCAGCGAACGTGGGCATCAACGACAGTGTCGACAGTCTGACTCCGTTCATGTCTCAGTTCCCCAGCAT
CACCGCTGCCGACCTCGTCCAGTTCGCAGGCGCGGTCGCACTGAGCAACTGCCCA
GTAAGTAGTCGTGAGCTGCCCATCTCCTGCTGTATTCGTGCTCACACGATCACCCACGATAGGGC
GCGCCCCAACTGGAGTTTCTTGCCGGTCGTCCCAATGCTACTGCGCCGGCCGTCGAGGGCCTGATCCCCGAACCACAGGACAACATCACGTCGATCCTGGACCGGTTCGCCGATGCCGGT
AGCTTCAGCCCGTTCGAGGTTGTCTCCCTCCTTGCCTCTCACTCTATTGCTCGTGCCGATAAGGTCGACCCGACCATCGACGCCGCGCCATTCGACTCC
GTAAGCGAAAATACTTGCTGT
CGTGAGATCACGCTAGATATTGTTTGCAGACCCCATTCGTGTTTGACACCCAGGTCTTCCTCGAGGTTCTCCTCAGGGGCGTCGGCTTCCCGGGTACCGACAACAACACCGGCGAGGTCG
AGTCCCCACTCCCGCTCACCGTCGGCAGCGACACCGGCGAGATGCGTCTCCAATCGGACTTTGCACTCGCTCGCGACCCGCGCACGGCGTGCTTCTGGCAGGGCTTCGTCAACCAGCAGG
AGTTCATGGCATCGAGCTTCAAGGCGGCCATGTCCAAGCTTGCGATCCTGGGCCACAATCGCGCGGACCTGGTCGACTGCTCGGCCGTCGTCCCCGTTCCGAAGCCGGCGGTGAACAAGC
CTGCGAGCTTCCCCGCCACCACTGGCCCGCAGGACCTGGAGCTGTCGTGCACGACCGAGAAGTTCCCGACGCTGACCGTCGACG
GTATGTGTTTTCAAACTGTGCACGCGCGGTGTATAA
TGGAGCTGACGATTGGCTATCGTACAGACGGCGCATACGAGACGGTGATCCCGCACTGCCCGGACGGCAGCATGACATGCAACGATGTCCGGTTCAGAGTCCAGGCCGTCGACTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCTCAAATTCTCTTCACTCATCGCCCTCGTCGCCGTTGCTGTGGCCGTGCACACTGCTTCAGCCTCCATCGCTGCCACCTGCTCCGACGGCACACAGGTCCCCGACAAGATGTGC
TGCAACTTCATCCCT
CTCATATCAGCGCTCCAGAATACTTTGTTCATGGAAGAATGCGGTGAAGATGCTCACGAGGTCATTCGTCTAACTTTCCATGATGCCATTGCTATCTCTCAGAGC
CAGGGTCCCGCGGC
CGGTGGAGGAGCCGACGGGTCGATGCTCATCTTCCCGACCGTCGAGCCATCGTTCGCAGCGAACGTGGGCATCAACGACAGTGTCGACAGTCTGACTCCGTTCATG
TCTCAGTTCCCCAGCATCACCGCTGCCGACCTCGTCCAGTTCGCAGGCGCGGTCGCACTGAGCAACTGCCCA
GGCGCGCCCCAACTGGAGTTTCTTGCCGGTCGTCCCAATGCTACTGCG
CCGGCCGTCGAGGGCCTGATCCCCGAACCACAGGACAACATCACGTCGATCCTGGACCGGTTCGCCGATGCCGGTAGCTTCAGCCCGTTCGAGGTTGTCTCCCTCCTTGCCTCTCACTCT
ATTGCTCGTGCCGATAAGGTCGACCCGACCATCGACGCCGCGCCATTCGACTCC
ACCCCATTCGTGTTTGACACCCAGGTCTTCCTCGAGGTTCTCCTCAGGGGCGTCGGCTTCCCGGGT
ACCGACAACAACACCGGCGAGGTCGAGTCCCCACTCCCGCTCACCGTCGGCAGCGACACCGGCGAGATGCGTCTCCAATCGGACTTTGCACTCGCTCGCGACCCGCGCACGGCGTGCTTC
TGGCAGGGCTTCGTCAACCAGCAGGAGTTCATGGCATCGAGCTTCAAGGCGGCCATGTCCAAGCTTGCGATCCTGGGCCACAATCGCGCGGACCTGGTCGACTGCTCGGCCGTCGTCCCC
GTTCCGAAGCCGGCGGTGAACAAGCCTGCGAGCTTCCCCGCCACCACTGGCCCGCAGGACCTGGAGCTGTCGTGCACGACCGAGAAGTTCCCGACGCTGACCGTCGACG
ACGGCGCATAC
GAGACGGTGATCCCGCACTGCCCGGACGGCAGCATGACATGCAACGATGTCCGGTTCAGAGTCCAGGCCGTCGACTATTAA

Retrieve as FASTA