Entry information : PcarMnP04
Entry ID 10797
Creation 2012-03-29 (Christophe Dunand)
Last sequence changes 2012-03-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarMnP04
Name PcarMnP04
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarMnP04
start..stop
S start..stop
PsoMnP02 607 0 1..377 1..377
CsuMnP04 606 0 1..377 1..377
PgigMnP04 606 0 1..381 1..392
CsuMnP05 602 0 1..377 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3176169..3176288 120 N° 2 3176347..3176398 52 N° 3 3176454..3176480 27 N° 4 3176539..3176578 40
N° 5 3176633..3176807 175 N° 6 3176862..3177083 222 N° 7 3177134..3177548 415 N° 8 3177611..3177705 95
join(3176169..3176288,3176347..3176398,3176454..3176480,3176539..3176578,3176633 ..3176807,3176862..3177083,3177134..3177548,3177611..3177705)


exon

Literature and cross-references PcarMnP04
DNA ref. JGI genome:   scaffold_5 (3176169..3177705)
Cluster/Prediction ref. JGI gene:   144982
Protein sequence: PcarMnP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382 (363)
PWM (Da):   %s   39629.56 (37733.5)  
PI (pH):   %s   4.28 (4.23) Peptide Signal:   %s   cut: 19 range:19-381
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFRSLLALVALAAVSNAAPTTVCPDGTHVSNAACCPFIPLIDDLQNTLFQGECGEDAHEAIRLTFHDAIAISQSQGPKAGGGADGSMLIFPTVEPGFHANAGISDSVNNLIPFLSTHNVSAGDLVQFAGAVALSNCPGAPRVQFLAGRPNATAPAVDGLIPEPQDGVSQILERFADAGNFSPFEVIALLASHSIARADKVDTSIDAAPFDSTPFVFDTQVYLEVLLKGVGFPGNGSQVGEVPSPLPAHSGNDTGEMRLQSDFALARDPRTACFWQGFVNEQDFMVSSFQAAFAKLAVLGHNPSKLIDCSEVVPTPKPAVNKPATFPATTGPQDLQLSCPTQKFPTLSVDPGAQETLIPHCPDGGQDCPSVQFSGPAPDIP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCGATCGCTCCTTGCCCTTGTGGCTCTCGCCGCTGTTTCCAACGCTGCACCGACCACGGTGTGCCCCGACGGCACCCATGTCAGCAACGCAGCTTGCTGCCCCTTCATTCCG
GTACGGAGTACTTAGTGACCATTGCCAGCTTGATTCTGACAGTGCATATACTTCGCAGCTTATCGACGACCTGCAGAACACCCTGTTCCAGGGCGAATGCGGTGAAGACGGTAGGTGTCC
GTCCGCTGACTCCAGCTGGACTTGCGCTGACTCTCTTTCTCGCAGCGCACGAGGCTATCCGACTGACTTTCCGTACGCATTATTCAAATGGTTTGCCGCTACCTGACTCGTGCTGACCAC
AAACCCCCAGACGACGCCATTGCTATCTCTCAGAGCCAGGGCCCGAAAGCGTGAGTTGCATTTCACATTTGAGACAGCATATCATCTAACGAAGACATTACCAGTGGCGGAGGTGCCGAT
GGCTCCATGCTCATCTTCCCCACCGTCGAACCAGGCTTCCACGCCAACGCCGGTATCAGCGACAGCGTTAATAACCTCATTCCCTTCCTTTCTACGCACAATGTCAGTGCCGGTGACCTC
GTCCAGTTTGCCGGCGCCGTTGCGCTGAGTAACTGCCCC
GTAAGTGTTCAGACGGGCTTCATTTTGGATGCAGGTTGGCTCATCCGCTACTAGGGTGCCCCCCGCGTTCAGTTCCTCGCC
GGTCGCCCGAACGCGACTGCCCCCGCCGTCGACGGCCTGATCCCCGAGCCTCAGGACGGCGTCAGCCAGATTCTCGAGCGGTTCGCCGACGCGGGCAACTTCAGTCCCTTTGAGGTTATC
GCGCTCCTGGCCTCACACTCCATCGCACGCGCTGACAAGGTTGACACGTCCATCGACGCCGCACCCTTCGACTCC
GTAAGTGACAATGCTTCCTATCCCAACATCACGCTAACCAGTACT
TGCAGACCCCATTCGTATTCGACACCCAGGTCTACCTCGAGGTCTTGCTCAAGGGTGTGGGCTTCCCCGGAAACGGCAGCCAAGTCGGTGAGGTCCCGTCCCCGCTTCCCGCGCACAGCG
GCAACGACACCGGCGAGATGCGTCTCCAGTCCGACTTTGCGCTCGCACGCGACCCGCGCACGGCCTGCTTCTGGCAGGGCTTCGTGAACGAGCAGGACTTCATGGTGTCGAGCTTCCAGG
CCGCGTTTGCCAAGCTCGCCGTCCTCGGCCACAACCCCAGCAAACTGATCGACTGCTCCGAGGTCGTGCCCACCCCGAAGCCGGCCGTCAACAAGCCCGCCACCTTCCCCGCCACCACCG
GCCCGCAGGACCTGCAGCTTTCGTGCCCCACCCAGAAGTTCCCGACCTTGTCTGTCGATC
GTGAGTGCCCACAGCCTCCCATTTCTGCGTTGGACACTAACGCTCTGTTCCCGCTGCCGC
AGCCGGTGCACAGGAGACCCTTATCCCTCACTGCCCTGACGGTGGCCAGGACTGCCCCTCGGTCCAGTTCAGCGGCCCTGCGCCTGATATCCCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCGATCGCTCCTTGCCCTTGTGGCTCTCGCCGCTGTTTCCAACGCTGCACCGACCACGGTGTGCCCCGACGGCACCCATGTCAGCAACGCAGCTTGCTGCCCCTTCATTCCG
CTTATCGACGACCTGCAGAACACCCTGTTCCAGGGCGAATGCGGTGAAGACGCGCACGAGGCTATCCGACTGACTTTCCACGACGCCATTGCTATCTCTCAGAGCCAGGGCCCGAAAGCT
GGCGGAGGTGCCGATGGCTCCATGCTCATCTTCCCCACCGTCGAACCAGGCTTCCACGCCAACGCCGGTATCAGCGACAGCGTTAATAACCTCATTCCCTTCCTTTCTACGCACAATGTC
AGTGCCGGTGACCTCGTCCAGTTTGCCGGCGCCGTTGCGCTGAGTAACTGCCCC
GGTGCCCCCCGCGTTCAGTTCCTCGCCGGTCGCCCGAACGCGACTGCCCCCGCCGTCGACGGCCTG
ATCCCCGAGCCTCAGGACGGCGTCAGCCAGATTCTCGAGCGGTTCGCCGACGCGGGCAACTTCAGTCCCTTTGAGGTTATCGCGCTCCTGGCCTCACACTCCATCGCACGCGCTGACAAG
GTTGACACGTCCATCGACGCCGCACCCTTCGACTCC
ACCCCATTCGTATTCGACACCCAGGTCTACCTCGAGGTCTTGCTCAAGGGTGTGGGCTTCCCCGGAAACGGCAGCCAAGTCGGT
GAGGTCCCGTCCCCGCTTCCCGCGCACAGCGGCAACGACACCGGCGAGATGCGTCTCCAGTCCGACTTTGCGCTCGCACGCGACCCGCGCACGGCCTGCTTCTGGCAGGGCTTCGTGAAC
GAGCAGGACTTCATGGTGTCGAGCTTCCAGGCCGCGTTTGCCAAGCTCGCCGTCCTCGGCCACAACCCCAGCAAACTGATCGACTGCTCCGAGGTCGTGCCCACCCCGAAGCCGGCCGTC
AACAAGCCCGCCACCTTCCCCGCCACCACCGGCCCGCAGGACCTGCAGCTTTCGTGCCCCACCCAGAAGTTCCCGACCTTGTCTGTCGATC
CCGGTGCACAGGAGACCCTTATCCCTCAC
TGCCCTGACGGTGGCCAGGACTGCCCCTCGGTCCAGTTCAGCGGCCCTGCGCCTGATATCCCTTAA

Retrieve as FASTA