Entry information : PcarLiP03
Entry ID 10798
Creation 2012-03-29 (Christophe Dunand)
Last sequence changes 2012-03-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-09-28 (Christophe Dunand)
Peroxidase information: PcarLiP03
Name PcarLiP03
Class Lignin peroxidase     [Orthogroup: LiP001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarLiP03
start..stop
S start..stop
PcarLiPC 478 5.55e-170 1..375 1..361
PsoLiP07 451 2.67e-159 1..375 1..363
PcarLiP04 451 5.32e-159 1..379 1..366
PcLiP06_RP78 447 7.22e-158 39..380 26..367
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10798' 'join(2018444..2018697,2018750..2018806,2018859..2019073,2019125..2019166,2019220..2019298,2019351..2019476,2019532..2019647,2019709..2019890,2019953..2020054)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2018444..2018697 252 N° 2 2018750..2018806 55 N° 3 2018859..2019073 213 N° 4 2019125..2019166 40
N° 5 2019220..2019298 77 N° 6 2019351..2019476 124 N° 7 2019532..2019647 114 N° 8 2019709..2019890 180
N° 9 2019953..2020054 100  
join(2018444..2018697,2018750..2018806,2018859..2019073,2019125..2019166,2019220 ..2019298,2019351..2019476,2019532..2019647,2019709..2019890,2019953..2020054)


exon

Literature and cross-references PcarLiP03
DNA ref. JGI genome:   scaffold_10 (2018444..2020054)
Cluster/Prediction ref. JGI gene:   152156
Protein sequence: PcarLiP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   390 (369)
PWM (Da):   %s   41932.61 (39677.3) Transmb domain:   %s   i7-26o
PI (pH):   %s   4.57 (4.46) Peptide Signal:   %s   cut: 22 range:22-390
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPKKLISLLFFALSISAVPATLLPARGSPRDDSLRAVEKRATCSNGASVSDQSCCVWVDVLEDIQENLFSGGQCDAEAHESLRLTFHDAIGYSSALAAEGKWPGGGADGSILAFSDTET
AFSANAGLDDIVELQKTFVEKHNVSPGDFIAFAGAVATSNCPGAPQMPFLAGRAPPTQASPPDLVPEPFDSVSKILNRVDDAGGFDEVDLVWLLASHSIASSNEIEPTNESFAFDTTPHT
FDSQFFVETLLVGTGFPGSSRARGEVKSPFPNQIRLQSDFAIARDPRTSCEWQNFVNNQTKMMKNFQSVFQNLTLIGQNVDQLTNCSDVIPISTPLPTNRPVSYFPYGKTINDIQQSCAT
APFPNLTTFSGPETSGTNVRACQRPRRHLG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). First and last introns are missing compared to other orthologs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCCAAAAAACTCATCTCCCTCCTCTTCTTCGCTCTCTCCATCTCCGCAGTGCCAGCCACGTTGCTGCCTGCTCGAGGGTCACCGCGAGACGACTCCCTACGTGCCGTCGAGAAG
CGTGCCACCTGCTCTAACGGCGCCTCCGTCAGTGACCAGTCGTGTTGCGTCTGGGTCGACGTCCTAGAAGACATCCAGGAAAACCTCTTCAGCGGCGGACAATGTGACGCTGAGGCCCAC
GAGTCCCTCCGTCT
CTGTAAGCTCAGCAATGCCCGTTACTCGATGGCTGTTCGCTGACATGGCTACAGTACCTTTCACGACGCAATCGGGTATTCTTCCGCGCTAGCAGCCGAGGGCAAG
TGGCC
CCGTATGTATCTACTGCCCTCAGCATTGTCTCAGCGTCTTACAATGTATGCCAGTGGTGGAGGCGCCGACGGCTCCATCCTCGCGTTCAGCGACACAGAAACTGCCTTCTCGGCG
AACGCCGGTCTCGACGATATCGTCGAACTCCAGAAGACTTTCGTCGAGAAGCACAACGTTTCTCCCGGCGACTTCATCGCCTTCGCTGGTGCGGTCGCAACGAGCAACTGCCCGGGTGCT
CCGCAGATGCCCTTCCTCGCTGGCCGCGCTCCCC
CCGTATGCTTGACGAATTTTTTCAGCAAATAGGCTCTGACTCGTATTTTACAGCTACCCAGGCTTCTCCTCCTGACCTTGTCCCCG
AGCCTTTCG
CGGTGTGTTGAGTGGACAGCATGAGCATCCGTACATAAACTTACTCTCTTCGTAGATTCTGTCAGCAAGATCCTTAACCGCGTCGACGATGCCGGCGGGTTCGATGAGGTA
GATCTCGTATGGCTGCTTGCTTC
TCGTGAGTAGTGTATGCGTTCGACACCGCATTGACGCTGACCATCCGACTTCAGCCATTCCATTGCTTCCTCCAACGAAATCGAGCCAACCAACGAG
TCCTTCGCGTTCGACACCACTCCTCACACTTTCGACTCCCAATTCTTCGTTGAGACTCTGCTTGTCGGCACTGGCTTCCCTGG
GGGTGCGTAATCTTTGAACCAGTGCCTGTGCGCGCAG
ACCGCTCACGGTTTGTTCAGCTCCTCTCGCGCTCGGGGCGAGGTCAAGTCGCCGTTCCCAAATCAGATACGTCTTCAGTCCGACTTCGCCATCGCGCGTGACCCGCGCACGTCCTGCGAG
TGGCAAAACTTCGTCA
CAGTGCGTACCGCCCCGTGCATTTCTCATCGCAGCAGAAACACGCTCACCGCGTACCTCGCAGATAACCAGACAAAGATGATGAAAAACTTCCAGTCCGTCTTC
CAAAACCTTACGCTGATCGGCCAGAACGTGGACCAGCTCACCAACTGCTCGGACGTCATTCCAATCTCTACGCCGCTCCCTACCAATCGTCCGGTCTCGTACTTCCCATATGGGAAGACC
ATAAACGATATCCAGCAGAGT
GTGTACGTAGTATCCCCCGATGCTGTGCATGAGGCGTGCCGCCCGCTGACTGCCCTTCCTGCAGTGCGCGACCGCGCCCTTCCCGAACCTTACGACGTT
CTCTGGTCCCGAGACTTCGGGTACGAACGTACGTGCCTGCCAACGACCGCGAAGGCACCTTGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCCAAAAAACTCATCTCCCTCCTCTTCTTCGCTCTCTCCATCTCCGCAGTGCCAGCCACGTTGCTGCCTGCTCGAGGGTCACCGCGAGACGACTCCCTACGTGCCGTCGAGAAG
CGTGCCACCTGCTCTAACGGCGCCTCCGTCAGTGACCAGTCGTGTTGCGTCTGGGTCGACGTCCTAGAAGACATCCAGGAAAACCTCTTCAGCGGCGGACAATGTGACGCTGAGGCCCAC
GAGTCCCTCCGTCT
TACCTTTCACGACGCAATCGGGTATTCTTCCGCGCTAGCAGCCGAGGGCAAGTGGCCTGGTGGAGGCGCCGACGGCTCCATCCTCGCGTTCAGCGACACAGAAACT
GCCTTCTCGGCGAACGCCGGTCTCGACGATATCGTCGAACTCCAGAAGACTTTCGTCGAGAAGCACAACGTTTCTCCCGGCGACTTCATCGCCTTCGCTGGTGCGGTCGCAACGAGCAAC
TGCCCGGGTGCTCCGCAGATGCCCTTCCTCGCTGGCCGCGCTCCCC
CTACCCAGGCTTCTCCTCCTGACCTTGTCCCCGAGCCTTTCGATTCTGTCAGCAAGATCCTTAACCGCGTCGAC
GATGCCGGCGGGTTCGATGAGGTAGATCTCGTATGGCTGCTTGCTTC
CCATTCCATTGCTTCCTCCAACGAAATCGAGCCAACCAACGAGTCCTTCGCGTTCGACACCACTCCTCACACT
TTCGACTCCCAATTCTTCGTTGAGACTCTGCTTGTCGGCACTGGCTTCCCTGG
CTCCTCTCGCGCTCGGGGCGAGGTCAAGTCGCCGTTCCCAAATCAGATACGTCTTCAGTCCGACTTC
GCCATCGCGCGTGACCCGCGCACGTCCTGCGAGTGGCAAAACTTCGTCA
ATAACCAGACAAAGATGATGAAAAACTTCCAGTCCGTCTTCCAAAACCTTACGCTGATCGGCCAGAACGTG
GACCAGCTCACCAACTGCTCGGACGTCATTCCAATCTCTACGCCGCTCCCTACCAATCGTCCGGTCTCGTACTTCCCATATGGGAAGACCATAAACGATATCCAGCAGAGT
TGCGCGACC
GCGCCCTTCCCGAACCTTACGACGTTCTCTGGTCCCGAGACTTCGGGTACGAACGTACGTGCCTGCCAACGACCGCGAAGGCACCTTGGCTGA

Retrieve as FASTA