Entry information : PcarLiP04
Entry ID 10799
Creation 2012-03-29 (Christophe Dunand)
Last sequence changes 2012-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-11 (Christophe Dunand)
Peroxidase information: PcarLiP04
Name PcarLiP04
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarLiP04
start..stop
S start..stop
PcarLiP01 652 0 1..372 1..372
PsoLiP07 639 0 1..372 1..373
PcarLiPC 624 0 1..372 1..371
PcLiP07_RF78 621 0 1..372 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1977174..1977234 61 N° 2 1977289..1977442 154 N° 3 1977496..1977552 57 N° 4 1977608..1977822 215
N° 5 1977875..1977916 42 N° 6 1977969..1978047 79 N° 7 1978100..1978341 242 N° 8 1978400..1978581 182
N° 9 1978640..1978704 65 N° 10 1978762..1978783 22  
join(1977174..1977234,1977289..1977442,1977496..1977552,1977608..1977822,1977875 ..1977916,1977969..1978047,1978100..1978341,1978400..1978581,1978640..1978704,19 78762..1978783)


exon

Literature and cross-references PcarLiP04
DNA ref. JGI genome:   scaffold_10 (1977174..1978702)
Cluster/Prediction ref. JGI gene:   213241
Protein sequence: PcarLiP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373 (351)
PWM (Da):   %s   38976.08 (36750.8)  
PI (pH):   %s   4.06 (4.01) Peptide Signal:   %s   cut: 22 range:22-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLIAALSVVLSLQAAQAAVVKSKRAACSNGASVSDESCCAWFDVLDDIQQNLFNGAQCGAEAHESIRLVFHDAIAISPALEAQGQFGGGGADGSIMIFDSVETAFQANVGLDEIVQLQKPFVAKHNVTPGDFIAFAGAVAMSNCPGAPQMNFFTGRAPATQAAPDGLVPEPFDDVTKIINRVNDAGQFDELELVWMLSAHSVAASNDIDPTVQGLPFDSTPGIFDSQFFVESQLRGTLFPGSGGNQGEVESGIPGEMRLQSDSLIARDSRTACEWQSFVNNQSKLTSDFQFIFLALTQLGQNPDVMTDCSAVIPLSKPIPGNGPFSFFPAGTSIADVEQACASTPFPSLTTLPGPATSVAHIPPPPGA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGCAACTCATCGCTGCTCTTTCCGTTGTGCTCTCTCTTCAGGCAGCCCAAGGTATGCCTTCTCCAGCTGCACATATCCCCTTACCGTGCTGATCGCGATGCGTAGCTGCC
GTGGTGAAGAGTAAGCGCGCAGCATGCTCCAACGGCGCCAGTGTCAGCGACGAGTCGTGCTGCGCGTGGTTCGACGTCCTCGACGACATTCAGCAGAACCTCTTCAACGGAGCTCAGTGC
GGGGCCGAGGCTCACGAGTCTATCCGTCT
GTAAGTGCTCCTGGTTTTTCGCGATTTTGCGAGATGGCTTATCTGCAATCTAGCGTCTTCCACGATGCCATTGCCATCTCTCCTGCCCTTG
AGGCCCAGGGCCAGTTTGG
GTATGTTTCTTTCTTTATTAGTGTGCATCAAACGATCGCTAAGTGTGCTTAATAGCGGTGGTGGTGCCGACGGCTCCATCATGATCTTTGATAGCGTCGAG
ACTGCGTTCCAGGCGAATGTCGGCCTTGATGAGATTGTCCAACTCCAGAAACCATTCGTCGCGAAGCACAACGTTACCCCCGGCGACTTTATTGCGTTTGCCGGTGCGGTCGCGATGAGC
AACTGTCCGGGTGCTCCACAGATGAATTTCTTCACCGGCCGCGCTCCCG
GTAGGCTCGACTTGTTTACTCGACAAAAACGGCTCTAACCCGTACTGCGCAGCTACCCAAGCTGCTCCTGA
TGGTCTTGTCCCTGAGCCTTTCG
GTATGTTGACAGAACGGAACGATAATTTGTCTCTGGCTGACCGCTTTTGTAGACGATGTCACTAAGATTATCAACCGCGTCAACGATGCCGGCCAGT
TCGATGAGCTCGAGCTTGTCTGGATGCTTTCGGC
GTAAGTAGCTCGCACTTTTGCCGCCGCATGTGCCCTGACTATCTGACCTCAGCCACTCTGTTGCTGCTTCTAACGACATCGACCCG
ACTGTCCAAGGCCTGCCGTTTGACTCCACTCCCGGCATATTCGACTCCCAATTCTTCGTCGAATCCCAGCTTCGCGGCACTCTCTTCCCTGGCTCTGGCGGAAACCAAGGCGAGGTTGAG
TCTGGAATCCCGGGAGAAATGCGCCTGCAGTCCGACTCCTTGATCGCGCGCGACTCGCGCACGGCCTGCGAGTGGCAGTCCTTCGTCA
GTGCGTATAACCCCGAGCCCGATGTAACTACA
GTAGAAAGGCTGAAAACGGGTCACAGACAACCAGTCGAAGCTGACGAGCGACTTCCAGTTCATCTTCCTCGCGCTCACCCAGCTCGGTCAGAACCCGGACGTGATGACTGACTGCTCGGC
CGTCATTCCACTCTCTAAGCCGATCCCTGGCAACGGTCCGTTTTCGTTCTTCCCCGCTGGAACATCCATTGCCGACGTTGAGCAGGCC
GTGCGTACCCGTGTCACTCGAACATGAGCGTG
ACGATTAGACTGACTGTCCCTAACAGTGCGCATCCACCCCCTTCCCGAGTCTCACGACTCTACCCGGCCCGGCGACCTCGGTCGCGCACATGTACGTGGTCCTTCACTTAACTTTTTTTT
GAGAACATTTGCTCATGGGATCCTCCAGCCCGCCGCCTCCTGGTGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGCAACTCATCGCTGCTCTTTCCGTTGTGCTCTCTCTTCAGGCAGCCCAAGCTGCCGTGGTGAAGAGTAAGCGCGCAGCATGCTCCAACGGCGCCAGTGTCAGCGACGAG
TCGTGCTGCGCGTGGTTCGACGTCCTCGACGACATTCAGCAGAACCTCTTCAACGGAGCTCAGTGCGGGGCCGAGGCTCACGAGTCTATCCGTCT
CGTCTTCCACGATGCCATTGCCATC
TCTCCTGCCCTTGAGGCCCAGGGCCAGTTTGG
CGGTGGTGGTGCCGACGGCTCCATCATGATCTTTGATAGCGTCGAGACTGCGTTCCAGGCGAATGTCGGCCTTGATGAGATTGTCCAA
CTCCAGAAACCATTCGTCGCGAAGCACAACGTTACCCCCGGCGACTTTATTGCGTTTGCCGGTGCGGTCGCGATGAGCAACTGTCCGGGTGCTCCACAGATGAATTTCTTCACCGGCCGC
GCTCCCG
CTACCCAAGCTGCTCCTGATGGTCTTGTCCCTGAGCCTTTCGACGATGTCACTAAGATTATCAACCGCGTCAACGATGCCGGCCAGTTCGATGAGCTCGAGCTTGTCTGGATG
CTTTCGGC
CCACTCTGTTGCTGCTTCTAACGACATCGACCCGACTGTCCAAGGCCTGCCGTTTGACTCCACTCCCGGCATATTCGACTCCCAATTCTTCGTCGAATCCCAGCTTCGCGGC
ACTCTCTTCCCTGGCTCTGGCGGAAACCAAGGCGAGGTTGAGTCTGGAATCCCGGGAGAAATGCGCCTGCAGTCCGACTCCTTGATCGCGCGCGACTCGCGCACGGCCTGCGAGTGGCAG
TCCTTCGTCA
ACAACCAGTCGAAGCTGACGAGCGACTTCCAGTTCATCTTCCTCGCGCTCACCCAGCTCGGTCAGAACCCGGACGTGATGACTGACTGCTCGGCCGTCATTCCACTCTCT
AAGCCGATCCCTGGCAACGGTCCGTTTTCGTTCTTCCCCGCTGGAACATCCATTGCCGACGTTGAGCAGGCC
TGCGCATCCACCCCCTTCCCGAGTCTCACGACTCTACCCGGCCCGGCG
ACCTCGGTCGCGCACAT
CCCGCCGCCTCCTGGTGCTTAG

Retrieve as FASTA