Entry information : OsPrx70(LOC_Os05g04490)
Entry ID 1080
Creation 2005-07-21 (Filippo Passardi)
Last sequence changes 2005-07-21 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-11 (Christophe Dunand)
Peroxidase information: OsPrx70(LOC_Os05g04490)
Name OsPrx70(LOC_Os05g04490)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx70
start..stop
S start..stop
SiPrx108 549 0 1..336 1..336
SiPrx107 540 0 2..336 1..333
ZmPrx22 530 0 2..336 1..338
ZmPrx146 530 0 2..336 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2013354..2013572 219 N° 2 2013921..2014712 792  
join(2013354..2013572,2013921..2014712)


exon

Literature and cross-references OsPrx70(LOC_Os05g04490)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1M3
DNA ref. GenBank:   NC_008398.1 (2013357..2014709)
Protein sequence: OsPrx70(LOC_Os05g04490)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (315)
PWM (Da):   %s   36115.96 (33866.9)  
PI (pH):   %s   6.5 (6.34) Peptide Signal:   %s   cut: 21 range:21-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMRSPWMVFAWAAAMVAVAAASPVPTKLKVGFYEHSCPQAEEIVRNAVRRAVARDPGLAAGLIRMHFHDCFVRGCDGSILINSTPGHVAEKDSVANNPSMRGFEVVDDAKAIVEAHCPRTVSCADILAFAARDSAHLAGATVDYPVPSGRRDGRVSVSDEVLADNVPAPTFSLAQLVASFERKGLTADDMVTLSGAHTIGRSHCSSFTARLYNFSGEAGRTDPAIDPAYAAELKRRCPPATDDQMDPTTVPLDPVTPASFDNQYYKNVLKHRVVLNSDQALLDSPWTAGVVKLHSAVEKVFQVKFAAAMVKMGNIDVLTGDEGEIREKCFMVNNHY*

Retrieve as FASTA  
Remarks chromosome 5. No ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGGTCGCCGTGGATGGTGTTTGCATGGGCGGCGGCGATGGTGGCCGTGGCGGCGGCGTCGCCGGTGCCGACGAAGCTGAAGGTGGGGTTCTACGAGCACAGTTGCCCGCAGGCG
GAGGAGATCGTCCGCAACGCCGTCCGCCGCGCCGTCGCCCGTGACCCCGGCCTCGCCGCCGGCCTCATCCGCATGCATTTCCACGACTGCTTCGTCAGA
GTAAGTACACATATATCACGT
GCCATTCTTGAAGAAGCTGTCAATGGCGTGTAATTAATTAAGGCCTCTAATTAGTCATGATTAGATGATACTTTCTCTGTTTTAGTCAAACTAATTTATAGAAAAATAGAACAACATCTA
CAGCACCAAATTAGTTTCACTATATATGTAACGTTGAATACATTTTTGATAATATCATTGTGTCGTGTTGAAAGTTTTATTATATTTTTCTGTAAATTTGATTAAATTAAAAATTAATTT
TTGACTATGGAAAAAATTAAAAACGACTCATATTATAAAGAGGGACGAAATTAAACTAATTGTGCTGAATTTAATTGATTATTTCAGGGGTGTGACGGGTCGATACTGATAAACTCGACG
CCGGGACACGTGGCGGAGAAGGATTCGGTGGCGAACAACCCTAGCATGCGAGGGTTCGAGGTGGTGGACGACGCCAAGGCCATCGTCGAGGCGCACTGCCCGCGCACCGTCTCCTGCGCC
GACATCCTCGCCTTCGCCGCCCGCGACTCCGCCCACCTCGCCGGCGCCACCGTCGACTACCCGGTCCCCTCCGGCCGCCGCGACGGCCGCGTCTCCGTCTCCGACGAGGTGCTCGCCGAC
AACGTCCCCGCCCCGACCTTCAGCCTCGCCCAGCTCGTCGCCAGCTTCGAGCGCAAGGGCCTCACCGCCGACGACATGGTCACCCTCTCCGGCGCCCACACCATCGGCCGCTCCCACTGC
TCCTCCTTCACCGCCCGCCTCTACAACTTCAGCGGCGAGGCCGGCAGGACGGACCCGGCCATCGACCCGGCGTACGCGGCGGAGCTCAAGCGCCGGTGCCCGCCAGCGACCGACGACCAG
ATGGACCCCACCACCGTGCCGCTCGACCCGGTGACGCCGGCGAGCTTTGACAACCAGTACTACAAGAACGTGCTCAAGCACAGGGTGGTGCTCAACTCCGACCAGGCGCTGCTCGACAGC
CCGTGGACCGCCGGCGTCGTCAAGCTCCACTCCGCCGTCGAGAAGGTGTTCCAGGTCAAGTTCGCCGCCGCCATGGTGAAGATGGGCAACATCGACGTGCTCACGGGTGACGAGGGAGAG
ATCAGAGAGAAGTGCTTCATGGTCAACAACCACTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAGGTCGCCGTGGATGGTGTTTGCATGGGCGGCGGCGATGGTGGCCGTGGCGGCGGCGTCGCCGGTGCCGACGAAGCTGAAGGTGGGGTTCTACGAGCACAGTTGCCCGCAGGCG
GAGGAGATCGTCCGCAACGCCGTCCGCCGCGCCGTCGCCCGTGACCCCGGCCTCGCCGCCGGCCTCATCCGCATGCATTTCCACGACTGCTTCGTCAGA
GGGTGTGACGGGTCGATACTG
ATAAACTCGACGCCGGGACACGTGGCGGAGAAGGATTCGGTGGCGAACAACCCTAGCATGCGAGGGTTCGAGGTGGTGGACGACGCCAAGGCCATCGTCGAGGCGCACTGCCCGCGCACC
GTCTCCTGCGCCGACATCCTCGCCTTCGCCGCCCGCGACTCCGCCCACCTCGCCGGCGCCACCGTCGACTACCCGGTCCCCTCCGGCCGCCGCGACGGCCGCGTCTCCGTCTCCGACGAG
GTGCTCGCCGACAACGTCCCCGCCCCGACCTTCAGCCTCGCCCAGCTCGTCGCCAGCTTCGAGCGCAAGGGCCTCACCGCCGACGACATGGTCACCCTCTCCGGCGCCCACACCATCGGC
CGCTCCCACTGCTCCTCCTTCACCGCCCGCCTCTACAACTTCAGCGGCGAGGCCGGCAGGACGGACCCGGCCATCGACCCGGCGTACGCGGCGGAGCTCAAGCGCCGGTGCCCGCCAGCG
ACCGACGACCAGATGGACCCCACCACCGTGCCGCTCGACCCGGTGACGCCGGCGAGCTTTGACAACCAGTACTACAAGAACGTGCTCAAGCACAGGGTGGTGCTCAACTCCGACCAGGCG
CTGCTCGACAGCCCGTGGACCGCCGGCGTCGTCAAGCTCCACTCCGCCGTCGAGAAGGTGTTCCAGGTCAAGTTCGCCGCCGCCATGGTGAAGATGGGCAACATCGACGTGCTCACGGGT
GACGAGGGAGAGATCAGAGAGAAGTGCTTCATGGTCAACAACCACTACTAG

Retrieve as FASTA