Entry information : TcinLiP01_DSH97 (lip1)
Entry ID 10805
Creation 2012-04-04 (Christophe Dunand)
Last sequence changes 2012-04-04 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-04-04 (Christophe Dunand)
Peroxidase information: TcinLiP01_DSH97 (lip1)
Name (synonym) TcinLiP01_DSH97 (lip1)
Class Lignin peroxidase     [Orthogroup: LiP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Pycnoporus
Organism Trametes cinnabarina (Pycnoporus cinnabarinus)    [TaxId: 5643 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TcinLiP01_DSH97
start..stop
S start..stop
TvLiP01 356 5e-125 1..203 76..278
TvLiP09 345 8e-121 1..203 74..274
TcinLiP02_DSH97 327 5e-116 1..203 1..203
TcinLiP03_DSH97 324 1e-114 1..203 1..203
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..49 49 N° 2 104..238 135 N° 3 299..725 427  
join(1..49,104..238,299..725)


exon

Literature and cross-references TcinLiP01_DSH97 (lip1)
Literature Morgenstern,I., Robertson,D.L. and Hibbett,D.S. Characterization of 3 mnp genes in Fomitiporia mediterranea and report of additional class II peroxidases in the Hymenochaetales
DNA ref. GenBank:   HM480294.1 [Fragment]
Protein sequence: TcinLiP01_DSH97 (lip1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   21357.66  
PI (pH):   %s   4.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
DAIAISPALEAQGKFGGGGADGSIAIFSEIETGFHPNIGLDEIVEKQRPFINRHNLGVADFIQFAGAIGASNCPGAPQLAAFVGRKDATQPAPDGLVPEPFHTPDQIFDRLADASQGEFDPILTVWLLTAHTVAAANDVDPTIPGSPFDSTPGVFDSQFFVETTLQGTLFPGDGPNQGEVKSPLRGEMRLQSDFLIARDNRTA

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' and 3' end are missing). Strain="DSH 97-310".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGATGCCATTGCTATCTCGCCGGCCCTTGAGGCCCAAGGCAAATTCGGGTAAGCGTAAGTTCGTCCGTTGAGGAGCACCTGCTTACCCTTGCATGTTGACAGTGGTGGCGGCGCCGACG
GTTCCATCGCTATCTTCTCAGAGATCGAGACCGGGTTCCACCCCAACATTGGACTCGATGAAATCGTAGAGAAGCAGCGGCCGTTCATCAACCGTCACAACCTCGGTGTTGCCGACTT
GT
GAGTCATACTTTGTGAACTGAGACCGCGTCACTTGCTAAATAATTTCACGCATCACAGCATCCAATTCGCGGGTGCGATTGGTGCCTCGAACTGCCCGGGTGCTCCTCAGCTCGCTGCGT
TCGTCGGCCGCAAGGACGCCACTCAGCCAGCCCCCGACGGTCTCGTTCCCGAGCCCTTCCACACGCCGGACCAAATTTTCGACCGTCTCGCTGATGCATCCCAGGGAGAATTCGACCCGA
TCTTGACTGTCTGGCTCTTGACTGCTCACACTGTTGCTGCCGCCAACGACGTGGACCCAACCATCCCCGGATCACCATTCGACTCCACTCCTGGCGTGTTCGACAGCCAATTCTTCGTCG
AGACCACCCTTCAGGGCACTCTCTTCCCGGGTGACGGTCCTAACCAGGGAGAGGTCAAGTCTCCTCTTCGCGGAGAGATGCGTCTCCAGTCCGACTTCTTGATCGCTCGCGACAACCGCA
CTGCC

Retrieve as FASTA