Entry information : TcinLiP02_DSH97 (lip2)
Entry ID 10806
Creation 2012-04-04 (Christophe Dunand)
Last sequence changes 2012-04-04 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-04-04 (Christophe Dunand)
Peroxidase information: TcinLiP02_DSH97 (lip2)
Name (synonym) TcinLiP02_DSH97 (lip2)
Class Lignin peroxidase     [Orthogroup: LiP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Pycnoporus
Organism Trametes cinnabarina (Pycnoporus cinnabarinus)    [TaxId: 5643 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TcinLiP02_DSH97
start..stop
S start..stop
TvLiP02_PRL572 358 1e-125 1..203 75..277
TvLiP02 358 1e-125 1..203 75..277
TvLiP09 334 2e-116 1..203 74..274
TcinLiP01_DSH97 325 4e-115 1..203 1..203
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..49 49 N° 2 106..240 135 N° 3 298..724 427  
join(1..49,106..240,298..724)


exon

Literature and cross-references TcinLiP02_DSH97 (lip2)
Literature Morgenstern,I., Robertson,D.L. and Hibbett,D.S. Characterization of 3 mnp genes in Fomitiporia mediterranea and report of additional class II peroxidases in the Hymenochaetales
DNA ref. GenBank:   HM480296.1 [Fragment]
Protein sequence: TcinLiP02_DSH97 (lip2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   21154.68  
PI (pH):   %s   4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
DAIAISPALEAQGIFGGGGADGSIAIFSDIETGFHPNIGLDEIVELQKPFIARHNLSVADFIQFAGAIGASNCAGAPQLAAFVGRVDATKPAPDGLVPEPFHTPDQIFARLADASQGEFDEILTVWLLVAHTVAAANDVDPTVPGSPFDSTPEIWDTQFFIETLLNGTTFPGTANNQGEVAAPLKGLLRLQSDFAIARDNRSA

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' and 3' end are missing). strain="DSH 97-310"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACGACGCTATCGCCATCTCTCCTGCACTAGAAGCTCAAGGTATCTTTGGGTAAGCGTAGTGCCTCGTTCCTGGCGACATTCTTACTGATACTGCTTCTCCTGCAGTGGTGGAGGGGCTGA
CGGGTCCATCGCTATCTTCTCTGATATTGAGACCGGGTTTCACCCCAACATTGGTCTTGACGAGATCGTCGAGTTGCAGAAGCCCTTCATCGCACGCCACAATCTCTCCGTCGCCGACTT
GTGAGTATAACTCATGCCCTACGGTTGTATAGCATTAAGGTATCATGACTTCCATAGCATTCAGTTCGCCGGTGCTATCGGTGCTTCAAACTGTGCCGGTGCTCCTCAGCTCGCCGCCTT
TGTCGGCCGCGTCGATGCTACTAAGCCCGCCCCCGATGGCCTTGTTCCGGAGCCATTCCACACTCCGGACCAGATTTTTGCACGTCTGGCCGATGCATCGCAGGGTGAATTCGACGAGAT
CTTGACTGTGTGGCTCCTTGTCGCCCACACCGTCGCGGCGGCGAACGATGTCGACCCGACTGTCCCTGGGTCGCCCTTCGATTCTACTCCCGAGATCTGGGACACGCAGTTCTTCATCGA
GACCCTGCTCAACGGTACTACCTTCCCCGGCACCGCAAACAACCAAGGCGAGGTCGCTGCACCCCTCAAGGGTCTTCTCCGCCTCCAGTCAGACTTTGCAATCGCTCGTGACAACCGTTC
TGCC

Retrieve as FASTA