Entry information : TcinLiP03_DSH97 (lip3)
Entry ID 10807
Creation 2012-04-04 (Christophe Dunand)
Last sequence changes 2012-04-04 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-04-04 (Christophe Dunand)
Peroxidase information: TcinLiP03_DSH97 (lip3)
Name (synonym) TcinLiP03_DSH97 (lip3)
Class Lignin peroxidase     [Orthogroup: LiP002]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Pycnoporus
Organism Trametes cinnabarina (Pycnoporus cinnabarinus)    [TaxId: 5643 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TcinLiP03_DSH97
start..stop
S start..stop
TvLiP12_PRL572 370 2.34e-130 1..203 75..277
TvLiP12 370 2.34e-130 1..203 75..277
TvLiP08 367 1.51e-129 1..203 75..277
TvLiP 348 6.23e-122 1..203 81..283
Gene structure Fichier Exons


exon

Literature and cross-references TcinLiP03_DSH97 (lip3)
Literature Morgenstern,I., Robertson,D.L. and Hibbett,D.S. Characterization of 3 mnp genes in Fomitiporia mediterranea and report of additional class II peroxidases in the Hymenochaetales
DNA ref. GenBank:   HM480298.1 [Fragment]
Protein sequence: TcinLiP03_DSH97 (lip3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203
PWM (Da):   %s   21332.55  
PI (pH):   %s   4.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
DAIAISPALEAQGKFGGGGADGSIAIFADIETNFHPNIGLDEVVEMQKPFIARHNLSVADFIQFAGAIGVSNCAGAPQLSAFVGRKDATQPAPDGLVPEPFHTPDQIFDRLADASQGEFD
PILTVWLLTAHTVAAANDVDPTRSGLPFDSTPELWDTQFFVETQLRGTSFPGSGGNQGEVESALAGELRLQSDHTIARDSRTA

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' and 3' end are missing). strain="DSH 97-310"
DNA
Send to BLAST