Entry information : PinvGPx
Entry ID 10812
Creation 2012-04-10 (Christophe Dunand)
Last sequence changes 2012-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-10 (Christophe Dunand)
Peroxidase information: PinvGPx
Name PinvGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus involutus    [TaxId: 71150 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PinvGPx
start..stop
S start..stop
PrubGPx01 398 1.74e-143 1..222 1..219
PadelGPx01 321 6.95e-114 59..222 1..164
GliviGPx01 306 4.37e-108 59..222 1..164
HpinGPx01 305 1.21e-107 59..222 1..164
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10812' 'complement(join(194571..194687,194748..194921,194979..195046,195107..195129,195206..195495))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 195206..195495 288 N° 2 195107..195129 21 N° 3 194979..195046 66 N° 4 194748..194921 172
N° 5 194571..194687 115  
complement(join(194571..194687,194748..194921,194979..195046,195107..195129,1952 06..195495))


exon

Literature and cross-references PinvGPx
DNA ref. JGI genome:   scaffold_30 (195495..194571)
Cluster/Prediction ref. JGI gene:   100685
Protein sequence: PinvGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   223 (372)
PWM (Da):   %s   25120.86 (41000.5)  
PI (pH):   %s   9.35 (6.68) Peptide Signal:   %s   cut: 27 range:22-393
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLATIPKSTRLLSLINRYHFRARIQSLPASRQPEHSRISVSIHQRFQLFHSTLSRQTMSSPTNFYDLKADLPNGNSYNFDELKGKVVLIVNVASQCGFTSQYKGLQALYDKYKDRGFLI
LGFPCNQFAGQEPGDDATIASFCERNHGVTFPLMKKSDVNGDDANPVYEWLKNEKAGILGLTRIKWNFEKFLVDREGTVVNRWASTTTPQAIDAAVETLLAAE*

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTATTAGCAACGATTCCTAAGTCCACTCGTCTTCTATCTCTTATAAACAGGTATCACTTCCGAGCTCGCATACAAAGTCTCCCAGCTTCGCGACAGCCCGAGCACTCACGAATATCT
GTTTCAATACATCAGCGCTTTCAGCTGTTCCACTCCACCCTATCAAGACAGACCATGTCCTCGCCTACCAATTTCTACGACCTCAAGGCTGACCTTCCCAATGGAAACAGCTATAACTTC
GACGAATTGAAAGGGAAAGTGGTTCTCATTGTCAATGTTGCATCGCAATG
GTGCGTCAGGTGTTTCGACCGGGTTTGTGGAAACCCCGAGACAGCCCGAGACTCACTGAACTGTATGGAA
CTACAGTGTGGATTCACTTCTCAGTACAAAGGTGCGGCGAATCTGTTGTATACTGGCTACCTTTTGGTGGGAACTGATTAACAATTTAAAGGTGTCTCCAAGCTCTATATGACAAATACA
AAGACCGCGGATTCCTGATTCTCGGGTTCCCTTGCAACCAA
GTGAGTGAGCTCGCGTGTCACTTCCGAATCCTGGTCTCTTAACATCTCCCTACCTAGTTTTTGCTGGTCAGGAGCCTGG
TGACGACGCAACCATCGCATCATTCTGTGAGCGCAATCACGGAGTCACCTTCCCCCTCATGAAGAAATCCGACGTCAATGGAGACGACGCCAATCCCGTTTACGAATGGCTCAAGAACGA
GAAAGCAGGAATCTTGGGCTTGACACGGATCAAG
GTTCGTGCGTGACTGTGCCTTGACTCTGCTGGGGTCTGATGGGGCCGTTGCTTTATGTAGTGTGGAACTTTGAGAAGTTTTTAGTC
GATCGGGAGGGCACGGTCGTAAATCGCTGGGCGTCAACTACGACTCCCCAAGCAATCGACGCTGCCGTGGAGACGCTGCTTGCTGCTGAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTATTAGCAACGATTCCTAAGTCCACTCGTCTTCTATCTCTTATAAACAGGTATCACTTCCGAGCTCGCATACAAAGTCTCCCAGCTTCGCGACAGCCCGAGCACTCACGAATATCT
GTTTCAATACATCAGCGCTTTCAGCTGTTCCACTCCACCCTATCAAGACAGACCATGTCCTCGCCTACCAATTTCTACGACCTCAAGGCTGACCTTCCCAATGGAAACAGCTATAACTTC
GACGAATTGAAAGGGAAAGTGGTTCTCATTGTCAATGTTGCATCGCAATG
TGGATTCACTTCTCAGTACAAAGGTCTCCAAGCTCTATATGACAAATACAAAGACCGCGGATTCCTGATT
CTCGGGTTCCCTTGCAACCAA
TTTGCTGGTCAGGAGCCTGGTGACGACGCAACCATCGCATCATTCTGTGAGCGCAATCACGGAGTCACCTTCCCCCTCATGAAGAAATCCGACGTCAAT
GGAGACGACGCCAATCCCGTTTACGAATGGCTCAAGAACGAGAAAGCAGGAATCTTGGGCTTGACACGGATCAAG
TGGAACTTTGAGAAGTTTTTAGTCGATCGGGAGGGCACGGTCGTA
AATCGCTGGGCGTCAACTACGACTCCCCAAGCAATCGACGCTGCCGTGGAGACGCTGCTTGCTGCTGAGTGA

Retrieve as FASTA