Entry information : PinvHalPrx03
Entry ID 10814
Creation 2012-04-13 (Christophe Dunand)
Last sequence changes 2012-04-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-13 (Christophe Dunand)
Peroxidase information: PinvHalPrx03
Name PinvHalPrx03
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus involutus    [TaxId: 71150 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PinvHalPrx03
start..stop
S start..stop
SlutHalPrx03 313 2e-108 13..251 7..245
SbreHalPrx03 303 1e-104 19..254 17..252
AbHalPrx02_bisporus 219 4e-71 19..251 20..262
LbiHalPrx04 218 7e-71 9..249 1..244
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 237306..237481 176 N° 2 237543..238197 655  
join(237306..237481,237543..238197)


exon

Literature and cross-references PinvHalPrx03
DNA ref. JGI genome:   scaffold_25 (237306..238198)
Cluster/Prediction ref. JGI gene:   100431
Protein sequence: PinvHalPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   277
PWM (Da):   %s   30398.3  
PI (pH):   %s   5.85
Sequence 318
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTPASPVLASPVSPHDHHSHTTGVCPVTGNTHAFCAPQPGDLRSPCPALNTLANHGYLPRNGKNVGVFDIVRALKEGYQLSTVLAYLLSFSGLFLLSQFRKMSLLDLSRHNLIEHDASLFHLDAHNDDEYAPPEVSDSLADISLKEGGRYQEGRMTLEDVANIRVKREEECRPLDGVHAEVARGEMAIAIGILGGKDAAESGLDLEVLRLWVEDERLPDGWKPDHTHGLYQTYKMTTVIRDRMKALKEKKIHNILDDNQSTPADATPAEETAKTK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTACCCCAGCCTCCCCTGTCCTGGCTTCGCCAGTTTCTCCCCATGACCACCACTCGCATACCACTGGCGTCTGTCCCGTGACAGGCAACACACATGCCTTTTGCGCACCACAACCTG
GGGATCTTAGGTCACCCTGCCCCGCATTGAACACCCTTGCAAATCATGGCTACTT
GTGAGTGACGATTATCAGAGAGTTGCTTCATCACACTAACCTACCACGCTCTCATTCATAGGCCA
CGGAATGGAAAGAATGTCGGCGTGTTCGACATCGTCCGCGCATTGAAAGAGGGTTACCAACTATCGACCGTCCTTGCTTACCTCCTCTCATTCAGCGGGCTCTTCCTTCTTTCCCAATTC
CGTAAAATGTCCCTCTTAGACCTCTCCCGTCACAACCTCATCGAACATGATGCATCGCTCTTTCACCTTGATGCCCACAACGACGACGAGTATGCACCTCCTGAGGTCTCAGATTCCCTG
GCAGATATCTCTCTTAAAGAGGGCGGACGCTATCAGGAAGGTCGCATGACCTTGGAGGATGTCGCGAACATCCGTGTCAAGAGGGAGGAAGAATGTAGACCGTTGGACGGTGTTCACGCA
GAGGTTGCACGCGGTGAAATGGCCATCGCGATCGGTATTCTTGGCGGGAAGGATGCCGCCGAGAGCGGTCTTGATCTCGAAGTCCTCCGCCTTTGGGTAGAGGACGAACGTCTCCCTGAT
GGCTGGAAGCCAGATCACACACACGGTCTCTACCAGACCTACAAGATGACCACGGTCATCCGGGACCGCATGAAGGCCTTGAAGGAGAAGAAAATCCATAACATCTTGGACGACAACCAA
TCTACGCCAGCCGATGCAACCCCGGCAGAGGAGACGGCAAAGACGAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTACCCCAGCCTCCCCTGTCCTGGCTTCGCCAGTTTCTCCCCATGACCACCACTCGCATACCACTGGCGTCTGTCCCGTGACAGGCAACACACATGCCTTTTGCGCACCACAACCTG
GGGATCTTAGGTCACCCTGCCCCGCATTGAACACCCTTGCAAATCATGGCTACTT
GCCACGGAATGGAAAGAATGTCGGCGTGTTCGACATCGTCCGCGCATTGAAAGAGGGTTACCAAC
TATCGACCGTCCTTGCTTACCTCCTCTCATTCAGCGGGCTCTTCCTTCTTTCCCAATTCCGTAAAATGTCCCTCTTAGACCTCTCCCGTCACAACCTCATCGAACATGATGCATCGCTCT
TTCACCTTGATGCCCACAACGACGACGAGTATGCACCTCCTGAGGTCTCAGATTCCCTGGCAGATATCTCTCTTAAAGAGGGCGGACGCTATCAGGAAGGTCGCATGACCTTGGAGGATG
TCGCGAACATCCGTGTCAAGAGGGAGGAAGAATGTAGACCGTTGGACGGTGTTCACGCAGAGGTTGCACGCGGTGAAATGGCCATCGCGATCGGTATTCTTGGCGGGAAGGATGCCGCCG
AGAGCGGTCTTGATCTCGAAGTCCTCCGCCTTTGGGTAGAGGACGAACGTCTCCCTGATGGCTGGAAGCCAGATCACACACACGGTCTCTACCAGACCTACAAGATGACCACGGTCATCC
GGGACCGCATGAAGGCCTTGAAGGAGAAGAAAATCCATAACATCTTGGACGACAACCAATCTACGCCAGCCGATGCAACCCCGGCAGAGGAGACGGCAAAGACGAAGTAA

Retrieve as FASTA