Entry information : OsPrx72(LOC_Os05g06970)
Entry ID 1082
Creation 2006-07-25 (Filippo Passardi)
Last sequence changes 2006-07-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-11 (Christophe Dunand)
Peroxidase information: OsPrx72(LOC_Os05g06970)
Name OsPrx72(LOC_Os05g06970)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Leaves
Roots
Inducers Fungus infection
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx72
start..stop
S start..stop
BdiPrx74 501 8e-180 1..340 4..338
SbPrx116 501 1e-179 13..359 17..363
SiPrx45 500 2e-179 1..334 1..330
ZmPrx03_Du101 491 6e-176 14..336 16..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3587420..3587632 213 N° 2 3586717..3587157 441 N° 3 3585802..3586227 426  
complement(join(3585802..3586227,3586717..3587157,3587420..3587632))


exon

Literature and cross-references OsPrx72(LOC_Os05g06970)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1M1
DNA ref. GenBank:   NC_008398.1 (3587617..3585805)
Protein sequence: OsPrx72(LOC_Os05g06970)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (335)
PWM (Da):   %s   37687.74 (35476.5)  
PI (pH):   %s   5.63 (5.11) Peptide Signal:   %s   cut: 20 range:20-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSAAMKLAVVAALISAAAVGARACLDVGFYDTTCPTAETLIQQVVAAAFRNDSGVAPAMIRMHFHDCFVRGCDGSVLIDTVPGSTTRAEKDAAPNNPSLRFFDVIDRAKSAVEAACPGVVSCADVVAFMARDGVVLSGGLGYQVPAGRRDGRTSLEDDALNFLPPPTSTAADLVANFTAKNLTAEDMVVLSGAHTIGVSHCDSFTNRIYNFPNTTDGIDPSLSKAYAFLLKGICPPNSNQTFPTTTTFMDILTPTKFDNRYYVGLTNNLGLFQSDAALLTDAALKATVNSFVRSEATFRLKFARAMIKMGQIGVLSGTQGEIRLNCRVVNPVNVTATAADDHHLTSSSSSSSDEVAAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 3') and 8 ESTs. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTCCGCGGCCATGAAGCTCGCCGTGGTGGCCGCGCTCATCTCGGCCGCCGCCGTGGGCGCCCGCGCCTGCCTCGACGTCGGCTTCTACGACACGACGTGCCCGACGGCGGAGACG
CTCATACAGCAGGTCGTCGCCGCCGCCTTCCGCAACGACTCCGGCGTCGCGCCGGCCATGATCCGCATGCATTTCCACGACTGCTTCGTCAGG
GTAAGTACTAAAGCACCATTATTAGAG
AAATCATTTTTTGTTCGTTACTCAAAATCTACAATAATCTTGGTTTAAATAGGAACCGGTCTAAGTTAAAACACCATACGGCACTTTTTAAAACGAAAGATTATTTTTAATCCCGATTTA
AAAGAAGGCAAGCTATGTCAGACCCCTCCACTCTTCTTTTGCTTCATGGATTTATGTGCCAAGTGCCAACTCATCGTCGTCTTCGTCCATGGCGGCGCGGTGATGATGCGTGCAGGGCTG
CGACGGCTCGGTGCTGATCGACACCGTGCCGGGGTCGACGACGAGGGCGGAGAAGGACGCCGCGCCAAACAACCCGAGCCTCCGGTTCTTCGACGTGATCGACCGCGCCAAGTCGGCCGT
CGAGGCGGCGTGCCCGGGCGTCGTCTCCTGCGCCGACGTCGTCGCCTTCATGGCGCGGGACGGCGTCGTGCTGTCCGGCGGCCTCGGCTACCAGGTGCCCGCGGGGCGGCGCGACGGCCG
GACCTCCCTCGAGGACGACGCGCTCAACTTCCTGCCGCCGCCAACGTCCACCGCCGCCGACCTCGTCGCCAACTTCACCGCCAAGAACCTCACCGCCGAGGACATGGTCGTCCTCTCCGG
CGCCCACACCATCGGCGTCTCCCACTGCGACTCCTTCACCAATCGCATCTACAACTTCCCCAACACAACCGATGGA
GTAAAATCTTCTTTAACCAACAACTCATCAAAGAAATGAAAAAA
CTGAAGAACATATGCAGAAGTGGATTTTCGTCCCTTTGGTGACATCCTCTCATTTTGTGCATGTCGTTTAAAAAATTATAAAAAAATTTAAAAAATTTGTGAAGATAGATCAATATGTGA
TATATCTTTTTACAAATATACGAGTTAAAATTCAATTTATACAATTTAAAATAAAAATAATAAATTTGACCATGAATTACACGTTCAATTCATAGTCAAATTTGTTATTTTTGTTTCTAT
TTGTATAAATTGAATTTGAATTTGCATGTTTATGAAGTGACATATCACATATTAATCAATCCTACTAAATTTTTTAAATTTTTTTGATGACTTTTAAGTGACATGTAAAAAATGAGAGAG
GATATCCCCTTACGGGATGTTTTGAGTTTTCCAGCATTTGAGTTCATCATTAGTCGTCTGACCTGTGTGATTATTTCGTGCGCAGATTGATCCGTCGTTGAGCAAGGCGTACGCGTTCTT
GCTGAAGGGCATCTGTCCGCCGAACAGCAACCAGACGTTCCCGACGACGACCACCTTCATGGACATCCTGACGCCGACCAAGTTCGACAACAGGTACTACGTCGGGCTGACAAACAACCT
CGGCCTCTTCCAGTCGGACGCGGCGCTGCTGACGGACGCCGCGCTCAAGGCCACGGTGAACTCCTTCGTGCGCAGCGAGGCGACGTTCCGGCTCAAGTTCGCCAGGGCCATGATCAAGAT
GGGGCAGATCGGCGTGCTGTCCGGGACGCAGGGCGAGATCAGGCTCAACTGCAGGGTCGTCAACCCTGTCAATGTCACTGCTACTGCAGCTGATGATCACCACCTTACTTCCTCTTCCTC
CTCTTCTTCAGATGAAGTGGCTGCAAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTCCGCGGCCATGAAGCTCGCCGTGGTGGCCGCGCTCATCTCGGCCGCCGCCGTGGGCGCCCGCGCCTGCCTCGACGTCGGCTTCTACGACACGACGTGCCCGACGGCGGAGACG
CTCATACAGCAGGTCGTCGCCGCCGCCTTCCGCAACGACTCCGGCGTCGCGCCGGCCATGATCCGCATGCATTTCCACGACTGCTTCGTCAGG
GGCTGCGACGGCTCGGTGCTGATCGAC
ACCGTGCCGGGGTCGACGACGAGGGCGGAGAAGGACGCCGCGCCAAACAACCCGAGCCTCCGGTTCTTCGACGTGATCGACCGCGCCAAGTCGGCCGTCGAGGCGGCGTGCCCGGGCGTC
GTCTCCTGCGCCGACGTCGTCGCCTTCATGGCGCGGGACGGCGTCGTGCTGTCCGGCGGCCTCGGCTACCAGGTGCCCGCGGGGCGGCGCGACGGCCGGACCTCCCTCGAGGACGACGCG
CTCAACTTCCTGCCGCCGCCAACGTCCACCGCCGCCGACCTCGTCGCCAACTTCACCGCCAAGAACCTCACCGCCGAGGACATGGTCGTCCTCTCCGGCGCCCACACCATCGGCGTCTCC
CACTGCGACTCCTTCACCAATCGCATCTACAACTTCCCCAACACAACCGATGGA
ATTGATCCGTCGTTGAGCAAGGCGTACGCGTTCTTGCTGAAGGGCATCTGTCCGCCGAACAGCAAC
CAGACGTTCCCGACGACGACCACCTTCATGGACATCCTGACGCCGACCAAGTTCGACAACAGGTACTACGTCGGGCTGACAAACAACCTCGGCCTCTTCCAGTCGGACGCGGCGCTGCTG
ACGGACGCCGCGCTCAAGGCCACGGTGAACTCCTTCGTGCGCAGCGAGGCGACGTTCCGGCTCAAGTTCGCCAGGGCCATGATCAAGATGGGGCAGATCGGCGTGCTGTCCGGGACGCAG
GGCGAGATCAGGCTCAACTGCAGGGTCGTCAACCCTGTCAATGTCACTGCTACTGCAGCTGATGATCACCACCTTACTTCCTCTTCCTCCTCTTCTTCAGATGAAGTGGCTGCAAGCTAA

Retrieve as FASTA