Entry information : EglPrx[P]46
Entry ID 10868
Creation 2012-05-03 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-08 (Christophe Dunand)
Peroxidase information: EglPrx[P]46
Name EglPrx[P]46
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]46
start..stop
S start..stop
EgrPrx[P]46 61 0.000000000000146 1..46 2..71
EgrPrx[P]42 60 0.000000000000424 1..46 5..73
EcamPrx[P]182 59 0.000000000000516 1..45 5..72
EcamPrx[P]42 57 0.00000000000322 1..46 5..77
Gene structure Fichier Exons


exon

Literature and cross-references EglPrx[P]46
Protein sequence: EglPrx[P]46
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   46 (25)
PWM (Da):   %s   5006.47 (2784.3)  
PI (pH):   %s   7.25 (5.45) Peptide Signal:   %s   cut: 22 range:22-46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SSSVNPAFLLLFRFLLGTTSAELSSTLYSKFWSSSALCFHDCFINA

Retrieve as FASTA  
Remarks Pseudogene from NGS. Short PS with gap in it.
DNA
Send to BLAST
CDS
Send to BLAST