Entry information : EglPrx[P]49
Entry ID 10872
Creation 2012-05-03 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EglPrx[P]49
Name EglPrx[P]49
Class Class III peroxidase     [Orthogroup: Prx025]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx[P]49
start..stop
S start..stop
EgrPrx[P]49 386 8e-138 1..238 15..252
EguPrx[P]49 365 7e-130 1..238 15..252
EglPrx48 217 2e-70 5..238 90..322
EgrPrx48 217 2e-70 5..238 90..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 43..186 144 N° 2 955..1524 570  
join(43..186,955..1524)


exon

Literature and cross-references EglPrx[P]49
Protein sequence: EglPrx[P]49
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236
PWM (Da):   %s   25956.18  
PI (pH):   %s   9.29
Sequence 279
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
KFTRPNFSVRRYDIIDEAKKIFKATCLSTVPYANMVMLATQDSVLLVGGLLAGGPSYNVPMRRRDGLVSYPNEVNLPRATFSISEATQAFMTKGFFTFTVTGTLLDAHSVGAAHCSLFQDRLSNFQGTWSSGSNDGLELGHEAEGHLQELNKQRPYRVFGPEHVVHGG*LVCKQIMQKKGVLRID*ELTIPAPASFLGSCQMRDESFACAMVRLGNIQVPTGNAKEIRRNCRIFNKPK

Retrieve as FASTA  
Remarks Pseudogene from NGS. 3' and PS are missing due to NNNN. Stops in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATTCACCAGGCCAAACTTCTCTGTACGACGATACGACATCATCGACGAAGCGAAGAAGATTTTCAAAGCTACGTGCCTTTCGACTGTCCCTTATGCTAACATGGTCATGCTCGCAACTC
AAGACTCTGTATTGCTCGTCGGT
AAACCTATCAAATTGGGTTTAAGACCCNNNNNNNNNNNNNNNNNAAATAAATAGGTCATATATGGGTCATTTCAATTTTGTAGAGCCTTCCTTAAAT
GTGTTTAAAATTTTAAAGGTTAAAATAAATGGATCTAAATGGGTTGAGTTTATGACCAATTTCCGACCAAAGGCTCACATACACACTCTCTCCTCTTTGGCCTTACAAAATTATTTTTTA
GAAAAATCAGATTATAATTATAATTATTTNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTCTTTCTTCTTCCTTCTTCCATCTTCCTTCGATTATATTGACTGACCAGGTGATGGACAAG
TTACCGGACTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNTATTTTCTTGGAAAACATTTTCCAAGAAACAAATGTAACCTCAATTATTTAAAAAAATTATAAAAAATGTCCATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGAAATTTACATTATAATAAATGGGTCATAAAGGG
GTTAAATGAGTCAATATGAGTCGGACCATTTATGATCCAATCCAAACCCGACTTAAGTTACCGATTTAACAGGTTTACTTGCCGGAGGCCCTAGCTATAATGTCCCTATGAGAAGGCGAG
ACGGTCTGGTTTCATACCCGAACGAAGTGAATTTGCCGAGAGCCACATTCTCGATATCTGAGGCGACACAAGCTTTCATGACAAAAGGGTTTTTTACGTTCACCGTAACGGGGACTCTTT
TGGACGCCCACTCCGTTGGAGCCGCTCACTGCAGCTTGTTCCAAGACCGCCTTTCGAATTTCCAAGGCACCTGGAGCTCTGGATCCAACGATGGACTAGAGCTTGGTCACGAAGCTGAAG
GGCATTTGCAGGAACTCAACAAGCAACGACCCTACCGCGTTTTTGGACCAGAGCACGTCGTTCATGGCGGATAACTCGTCTGCAAACAAATTATGCAAAAGAAAGGGGTGTTACGAATCG
ACTAGGAGCTCACAATTCCTGCGCCAGCATCGTTTCTCGGTTCATGTCAGATGCGAGATGAGAGCTTTGCGTGTGCGATGGTGAGGCTCGGAAATATTCAAGTTCCCACTGGGAATGCTA
AAGAAATCAGGAGGAATTGCAGGATTTTCAATAAACCCAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATTCACCAGGCCAAACTTCTCTGTACGACGATACGACATCATCGACGAAGCGAAGAAGATTTTCAAAGCTACGTGCCTTTCGACTGTCCCTTATGCTAACATGGTCATGCTCGCAACTC
AAGACTCTGTATTGCTCGTCGGT
GGTTTACTTGCCGGAGGCCCTAGCTATAATGTCCCTATGAGAAGGCGAGACGGTCTGGTTTCATACCCGAACGAAGTGAATTTGCCGAGAGCCACAT
TCTCGATATCTGAGGCGACACAAGCTTTCATGACAAAAGGGTTTTTTACGTTCACCGTAACGGGGACTCTTTTGGACGCCCACTCCGTTGGAGCCGCTCACTGCAGCTTGTTCCAAGACC
GCCTTTCGAATTTCCAAGGCACCTGGAGCTCTGGATCCAACGATGGACTAGAGCTTGGTCACGAAGCTGAAGGGCATTTGCAGGAACTCAACAAGCAACGACCCTACCGCGTTTTTGGAC
CAGAGCACGTCGTTCATGGCGGATAACTCGTCTGCAAACAAATTATGCAAAAGAAAGGGGTGTTACGAATCGACTAGGAGCTCACAATTCCTGCGCCAGCATCGTTTCTCGGTTCATGTC
AGATGCGAGATGAGAGCTTTGCGTGTGCGATGGTGAGGCTCGGAAATATTCAAGTTCCCACTGGGAATGCTAAAGAAATCAGGAGGAATTGCAGGATTTTCAATAAACCCAAG

Retrieve as FASTA