Entry information : EglPrx55
Entry ID 10877
Creation 2012-05-03 (Qiang Li)
Last sequence changes 2016-01-18 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-19 (Christophe Dunand)
Peroxidase information: EglPrx55
Name EglPrx55
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx55
start..stop
S start..stop
EgrPrx55 662 0 1..333 1..333
EguPrx55 658 0 1..333 1..333
EcamPrx55 647 0 1..333 1..332
MePrx53 515 0 3..333 5..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..225 225 N° 2 364..549 186 N° 3 678..849 172 N° 4 1204..1622 419
join(1..225,364..549,678..849,1204..1622)


exon

Literature and cross-references EglPrx55
Protein sequence: EglPrx55
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (305)
PWM (Da):   %s   34662.93 (31758.4)  
PI (pH):   %s   5.54 (4.70) Peptide Signal:   %s   cut: 29 range:29-333
Sequence 374
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVRSHAPSSLMGIAVFAALLFLLHPSSAQLSSNFYATSCPNVSNIVQTVIQQALQSDPRITASLLRLHFHDCFVDGCDGSLLLDNSANITSEKDAAPNTNSTRGFDVVDNIKSAIESSCPGTVSCADILALGAQASVLQSGGPSWTVLSGRRDSLTANQAGANTSIPSPFGSLANLTSKFAAVGLDTNDLVTLSGAHTFGRAQCRTFSPRLYNFNASGSPDPTISPSYLTTLQQLCPQNGSGSVxANLDPTTVNTFDNNYYANLQNNQGLLQSDQELFSTSGAATISIVNSFSGNQSAFFQSFAQSMINMGNISPLTGSSGEIRSNCKKVNGS

Retrieve as FASTA  
Remarks Complete sequence from NGS (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTCCGTTCTCACGCTCCTTCCTCGCTGATGGGGATAGCGGTTTTCGCCGCGTTGTTGTTTCTCCTCCATCCGTCGAGTGCTCAATTAAGCTCAAACTTTTATGCCACATCATGCCCGA
ATGTGTCCAACATCGTCCAAACCGTGATCCAGCAGGCCCTTCAATCCGACCCGCGCATCACCGCCAGCCTCCTCCGTCTCCATTTCCACGATTGCTTTGTTGAC
GTGAGTCCCTAAGCTT
GGTCTTGGTCAACTCCCGTTAACAGCGTGTCCTAAATTAAGCGTTTTTCGTTTTGACTTTCAATCCGATTATCGGGTAGTTGGTCACTTGAACTAACTTTTGAGCATACTATGTGTTGAC
AGGGGTGTGATGGATCGTTGTTGCTGGACAACAGCGCAAACATTACGAGTGAGAAAGACGCAGCTCCGAATACAAATTCGACAAGAGGGTTCGATGTGGTGGACAACATCAAATCAGCCA
TCGAGAGCTCTTGTCCTGGGACCGTGTCTTGCGCCGACATTCTCGCCCTCGGTGCTCAAGCTTCTGTC
GTTCTGGTAGACATAGCTATAGTCAAAGAAACTTTAAATATAAATTCAAAGC
ATATCTAGGGTTGGCTACTGATACTTGGCTTCCACGAATCATAATGGTGCTTCTCTTGATTGTCACTCTTATAAACTTGCAGTCAGGAGGTCCATCTTGGACGGTGCTCTCGGGGAGGAG
GGACAGCTTGACGGCGAACCAAGCAGGAGCGAACACATCGATACCTAGCCCTTTTGGTTCCTTGGCTAACCTCACTTCCAAATTCGCCGCTGTTGGCTTGGACACCAATGACCTTGTCAC
TCTTTCCG
GTAAAGAACCACAGACAAAAAGAAGAGCTAAAGTGTATTGTTGGACTTGCATATGAAGATCCAAAGGATGGTGTCAAAATTTGCATACAAACTCCTAGATTTATATGCTAAA
TGATAAGTTTACTAAGGTCGTTTTAAATTAATATATCAAGTAACATTGTAGATCGCAATTATTTTACATTTAACATGACCCACTTACTCAGATGCATCCTACTGAATTTGTCACATTTAT
TTGGTATACAACTTATTTTAAGCATACCTAGCATTGCTCTATTCATCGACTTCCATAACTGAGCATTTGCAGATTCTTTGTTCAGCCTCAGCTAACTTTTCGTGCATCTGATCATGAAAC
AGGAGCTCACACCTTTGGACGTGCACAGTGCAGGACATTCAGCCCTAGGCTCTACAACTTCAACGCGAGTGGCAGCCCAGATCCAACCATAAGTCCTTCATACTTGACCACTCTCCAACA
ACTTTGCCCACAGAATGGAAGCGGCTCCGTCCNCGCCAACCTCGACCCGACGACCGTGAACACATTCGACAACAACTACTACGCCAACCTCCAGAACAACCAAGGGCTTCTTCAGTCCGA
TCAAGAGCTGTTCTCAACATCTGGCGCCGCAACGATCTCCATCGTCAACAGCTTCAGCGGCAACCAGAGCGCCTTCTTCCAGAGCTTTGCTCAATCGATGATAAACATGGGAAACATTAG
TCCTCTCACCGGAAGTAGTGGGGAGATCAGATCGAATTGCAAGAAGGTCAACGGGAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTCCGTTCTCACGCTCCTTCCTCGCTGATGGGGATAGCGGTTTTCGCCGCGTTGTTGTTTCTCCTCCATCCGTCGAGTGCTCAATTAAGCTCAAACTTTTATGCCACATCATGCCCGA
ATGTGTCCAACATCGTCCAAACCGTGATCCAGCAGGCCCTTCAATCCGACCCGCGCATCACCGCCAGCCTCCTCCGTCTCCATTTCCACGATTGCTTTGTTGAC
GGGTGTGATGGATCGT
TGTTGCTGGACAACAGCGCAAACATTACGAGTGAGAAAGACGCAGCTCCGAATACAAATTCGACAAGAGGGTTCGATGTGGTGGACAACATCAAATCAGCCATCGAGAGCTCTTGTCCTG
GGACCGTGTCTTGCGCCGACATTCTCGCCCTCGGTGCTCAAGCTTCTGTC
TTGCAGTCAGGAGGTCCATCTTGGACGGTGCTCTCGGGGAGGAGGGACAGCTTGACGGCGAACCAAGCAG
GAGCGAACACATCGATACCTAGCCCTTTTGGTTCCTTGGCTAACCTCACTTCCAAATTCGCCGCTGTTGGCTTGGACACCAATGACCTTGTCACTCTTTCCG
GAGCTCACACCTTTGGAC
GTGCACAGTGCAGGACATTCAGCCCTAGGCTCTACAACTTCAACGCGAGTGGCAGCCCAGATCCAACCATAAGTCCTTCATACTTGACCACTCTCCAACAACTTTGCCCACAGAATGGAA
GCGGCTCCGTCCNCGCCAACCTCGACCCGACGACCGTGAACACATTCGACAACAACTACTACGCCAACCTCCAGAACAACCAAGGGCTTCTTCAGTCCGATCAAGAGCTGTTCTCAACAT
CTGGCGCCGCAACGATCTCCATCGTCAACAGCTTCAGCGGCAACCAGAGCGCCTTCTTCCAGAGCTTTGCTCAATCGATGATAAACATGGGAAACATTAGTCCTCTCACCGGAAGTAGTG
GGGAGATCAGATCGAATTGCAAGAAGGTCAACGGGAGTTGA

Retrieve as FASTA