Entry information : EglPrx69
Entry ID 10891
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2012-05-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EglPrx69
Name EglPrx69
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx69
start..stop
S start..stop
EgrPrx69 671 0 1..327 25..351
EcamPrx69 636 0 1..327 25..354
EguPrx69 630 0 1..327 25..351
EgrPrx83 590 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..225 225 N° 2 606..791 186 N° 3 1037..1202 166 N° 4 1651..2057 407
join(1..225,606..791,1037..1202,1651..2057)


exon

Literature and cross-references EglPrx69
Protein sequence: EglPrx69
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35237.08 (32267.4)  
PI (pH):   %s   7.86 (7.34) Peptide Signal:   %s   cut: 28 range:28-327
Sequence 368
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLILSCLLLQLMFSFLVLKVAHGQGLEVGFYQKACPNAEAIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRGCEGSVLLNSPTNQSEKDAPQNHNLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGGLFYDVETGRRDGCVSILGEASNDLIPSTANITTLKADFAKRGLSVKDLVVLSGGHTIGTSHCTAFSNRLYNFTGKGDTDPTLDSNYIARLKLSCKPNDQTTLVEMDPGSVRTFDIKYFDLIAKRRGLFTSDAALLDDSQTKAYLDFQIKTGGSTFFKDFGESMVKMGRIGVLTETSGEVRKVCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTGTCCGAAGCTCATCTTGTCTTGCTTGTTGCTTCAGTTGATGTTCTCGTTTCTTGTTCTTAAGGTCGCTCACGGTCAAGGTCTCGAAGTAGGGTTTTACCAGAAGGCATGCCCAA
ATGCAGAGGCAATCGTGAAGGAAGTCATCGGCCAAGTCATGTCCGTTGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGCTGCATTTTCATGATTGTTTCGTTAGG
GTAAGTAAGAGAGCAA
GCTCACATGCTTCTCTTCCTACTATGCATCCGAAGTTTACCATTTTCGAATTACATGATAATTTGCATGTAACTAATGTTCGGATTCTAAGATGAGTAGTAATTGGCAAAAAAAGAGGGT
GAGAAGTTAGATCTTGGGCTTTCACCTGAAGGGTAAATGCATGGTAGGGATGCATAGAGATTCACAAAATTGAATTGCCGGATAACAATTTGATAAAATGAAAAATGTGTATTCGATCTA
GTAATATCCTAATAAATGTTATTTGGCTCTCATCATCCTTCTCTTGATTCGTCTTTGGTTACGAACTGTTGTCTTCATGGACTCGTGGTTGAATAAAATGCTTTGTTTCTGGGCTTTTCC
ACAGGGTTGTGAAGGTTCGGTACTATTGAACTCTCCGACCAATCAATCCGAGAAGGATGCCCCTCAGAATCACAACCTTCGAGGTTTCCAAACGATAGATAGAGTCAAAACGGCATTGGA
GAAGGCATGCCCCGGCATCGTTTCGTGTGCTGACATCTTGGCCCTTGTCGCTAGAGACGTTGTCGTCGCG
GTGCGTGCATATTCATACATCACATCCTCTGTATTTTATTCTCAAATTTG
AATCTTTGTTACATAAGTACGACGTTAGTAGAATTCTCAATTTTTGCAAACAATCTGTGTTATCTCCTTGGAAAAACAAATATTAGCCACACGTATAATAGAGAATAAGCACCGACAATT
TTTGTTAATGAGAAATGCATTTTTATATAGAATTTGGGTTTTTTTTTTTTTTTGTTGTTGTTGTTGTCACTTTAGACTGGAGGACTTTTCTATGACGTGGAAACCGGACGAAGAGATGGG
TGTGTTTCTATTTTGGGGGAGGCATCTAACGATTTAATACCGTCTACAGCCAACATTACTACTCTGAAAGCAGATTTTGCAAAGAGAGGCCTCAGCGTGAAGGACCTTGTTGTCTTATCA
G
GTAACGCCTAATCTCCAATTACTGCTTCACATGCTTTGTAAAATATTTTGGGGAAATTTTCGAAAAGATGTGCCAATGTCCGTACTTAGCTTAGGCAACACAGGTCAAGCTTAGCCATC
TTCCCTTTCATTCTTCAGGTGGTCTGTAATTTTCCATGCACTCAGGCAAAATGAAACGAAGTTACTTATGCAATTTTTTTTTTCTTTTTTGATAACCTCAAACCAATTTGGGCTAGGCCG
TAGCGATCTCTAAACCCACGAATGAAAGCTCAAGAGGTGGAAGGTATTCCTTTGATCGGGGTACAATCTCTAAAAAGAGATAAGACATAAATTAATCGGGAAAAAAAACTGTAATTTGAG
CACGAGATACATAAACACAGTCACCAATACAGGGAGAAAACGTAATTTGTAACGGTGGATCATGCTAATTCTGATTTGCTATTGAGTAGGTGGGCACACCATTGGAACATCACACTGCAC
TGCCTTCTCCAACCGCCTCTACAACTTCACCGGAAAGGGCGACACTGACCCCACGCTCGACTCCAACTACATAGCAAGATTGAAGCTCAGTTGCAAGCCGAATGACCAAACCACTCTCGT
CGAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAGTACTTCGATCTCATCGCAAAGAGAAGAGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACCAAGGCATA
CCTTGACTTTCAAATCAAGACCGGTGGATCCACTTTCTTCAAGGACTTTGGAGAGTCAATGGTGAAAATGGGTCGGATTGGCGTGCTCACCGAAACGTCTGGTGAAGTCAGGAAAGTGTG
TTCAAAGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTGTCCGAAGCTCATCTTGTCTTGCTTGTTGCTTCAGTTGATGTTCTCGTTTCTTGTTCTTAAGGTCGCTCACGGTCAAGGTCTCGAAGTAGGGTTTTACCAGAAGGCATGCCCAA
ATGCAGAGGCAATCGTGAAGGAAGTCATCGGCCAAGTCATGTCCGTTGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGCTGCATTTTCATGATTGTTTCGTTAGG
GGTTGTGAAGGTTCGG
TACTATTGAACTCTCCGACCAATCAATCCGAGAAGGATGCCCCTCAGAATCACAACCTTCGAGGTTTCCAAACGATAGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCCGGCATCG
TTTCGTGTGCTGACATCTTGGCCCTTGTCGCTAGAGACGTTGTCGTCGCG
ACTGGAGGACTTTTCTATGACGTGGAAACCGGACGAAGAGATGGGTGTGTTTCTATTTTGGGGGAGGCAT
CTAACGATTTAATACCGTCTACAGCCAACATTACTACTCTGAAAGCAGATTTTGCAAAGAGAGGCCTCAGCGTGAAGGACCTTGTTGTCTTATCAG
GTGGGCACACCATTGGAACATCAC
ACTGCACTGCCTTCTCCAACCGCCTCTACAACTTCACCGGAAAGGGCGACACTGACCCCACGCTCGACTCCAACTACATAGCAAGATTGAAGCTCAGTTGCAAGCCGAATGACCAAACCA
CTCTCGTCGAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAGTACTTCGATCTCATCGCAAAGAGAAGAGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACCA
AGGCATACCTTGACTTTCAAATCAAGACCGGTGGATCCACTTTCTTCAAGGACTTTGGAGAGTCAATGGTGAAAATGGGTCGGATTGGCGTGCTCACCGAAACGTCTGGTGAAGTCAGGA
AAGTGTGTTCAAAGGTTAATTAA

Retrieve as FASTA