Entry information : EglPrx94
Entry ID 10915
Creation 2012-05-04 (Qiang Li)
Last sequence changes 2012-05-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EglPrx94
Name EglPrx94
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx94
start..stop
S start..stop
EgrPrx94 677 0 1..326 1..326
EcamPrx94 660 0 1..326 1..330
EguPrx94 655 0 1..326 1..326
GmPrx64 459 5.84e-164 33..326 48..342
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10915' 'join(1..234,778..1120,1390..1790)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..234 232 N° 2 778..1120 341 N° 3 1390..1790 399  
join(1..234,778..1120,1390..1790)


exon

Literature and cross-references EglPrx94
Protein sequence: EglPrx94
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (303)
PWM (Da):   %s   35902.32 (33435.9)  
PI (pH):   %s   9.1 (8.82) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAFVPSALFLVTLHLISATVRAGGLPVEAYGLSFQYYQESCPNF
EAIVSRKVKEWIKKDYTLAPALMRLHFHDCVVR
GCDASILLNYPGSERSAAESKTLRGFEVINDIKVALEKSCPKMASCADILTSAARDATVLAGGPFWMVPYGRKDGRVSVAKEASKVPVGHENVTSLLQLFQSQGLNVLDLVVLSGAHTIG
RSTCGSIQSRLYNYKSTGKPDPTLNREYGNYLKRKCRWASEYVYLDGRTPKTFDNMYYKNLQKKMGLLSTDQYLNSDSRTGPLVSALATQPELFNYQFGVSMAKLGNVQVLTGDEGEVRT
NCNAVNR

Retrieve as FASTA  
Remarks Complete sequen cefrom genomic (introns 1 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCCTTTGTGCCGTCGGCGCTGTTTCTCGTCACCCTTCACTTGATTTCGGCCACCGTCCGAGCAGGCGGGCTGCCGGTCGAAGCGTACGGGCTGTCGTTCCAGTACTACCAGGAG
AGTTGCCCCAATTTTGAGGCCATCGTGAGCAGGAAAGTGAAGGAATGGATTAAGAAGGACTATACTTTGGCACCAGCCCTGATGAGGTTGCATTTCCACGACTGCGTCGTCAGG
GGGTAC
GTAGTTTGTCCGACCGCTTTTTTTTTTTTTCTTTTTTTTTTAAATGAAAAAGGGCTAAAGCAGATTAAAAAAAGTTAACGTGGTAAATATACTATTTCTATTTTATCACCTGATAATAAT
AAATAAAAAAATTAGTATTCCAGCACTTGTCAATTCCAAAGTTAGCAATCTAGTCAGCAGAGCAATTTCCTTCTCCAAAATTATGTTGGTCAGCATCAACCAAATTATTTTCGTAAGTTT
TGCAAAAATCGCACTTATTAATAAAGTCGTCGCTAAGAAAAGCAACCAAAAATTTATTATCTAGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGAA
GTCTTTATAGTTAATGAATCAATACACTAACATTAATTAACTTATTGCATTATAATTTATATCTCACTCTTGATTGAGCTTTCTATAGACCAAATCAAAAAATTTCGACATCCAAGTAAA
CCAAAATGTGAATTTTTGCCGGCTTCATTTGACTCGAGTTTCTTGATTTGGTTGTGTAGGGATGCGACGCGTCGATACTATTGAACTACCCAGGGAGCGAGAGGAGCGCCGCAGAGAGCA
AGACTCTCAGGGGGTTCGAGGTGATCAACGACATAAAGGTAGCGCTTGAGAAGAGCTGCCCGAAGATGGCGTCGTGCGCTGACATCCTGACCTCGGCCGCGAGGGACGCCACCGTGTTGG
CCGGCGGGCCGTTCTGGATGGTCCCGTACGGGCGCAAGGATGGGAGGGTCTCCGTCGCCAAGGAGGCCAGCAAGGTGCCGGTTGGCCACGAGAACGTCACGTCTCTCCTCCAGCTTTTCC
AATCCCAAGGATTGAATGTCCTTGACTTGGTTGTTCTCTCAG
AGGTGAACTTTTTCTCATTTCTTTTCACAAATCAACGAAAAAATAAATAAATAAAAAAATAAAGTCTAAAACACTATA
TTCCATTTTTAATTTATTTATTATCTATATAGCAATTTTAGTCTATAGGGTGCTTTTTGAATGGATGTGAGGATTAGTTTATGAAATTTTTATGGTCAACTTTGATTAAAAAAAATCACC
ATGTATTCTCAAATATAATTGAAATGTACATTTTTAATTTTATTCTTTTTCCTTCTTCTTGATCCGGGTGCAGGCGCGCACACGATAGGGCGAAGCACCTGCGGGTCCATCCAATCGCGG
CTCTACAACTACAAGTCCACCGGAAAACCCGACCCGACCCTCAACCGGGAGTACGGGAACTACCTGAAGCGGAAGTGCCGGTGGGCGTCGGAGTACGTGTACCTCGACGGGAGGACCCCG
AAAACCTTCGATAACATGTACTACAAGAACTTGCAGAAGAAGATGGGCCTCCTCTCCACCGACCAGTACCTCAACTCCGACTCCCGGACCGGGCCGCTCGTGTCGGCGCTCGCCACCCAG
CCCGAGCTCTTCAACTACCAGTTCGGCGTCTCCATGGCCAAGCTCGGCAACGTCCAGGTGCTCACCGGCGACGAAGGCGAGGTCCGCACCAACTGCAACGCCGTCAACCGCTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCCTTTGTGCCGTCGGCGCTGTTTCTCGTCACCCTTCACTTGATTTCGGCCACCGTCCGAGCAGGCGGGCTGCCGGTCGAAGCGTACGGGCTGTCGTTCCAGTACTACCAGGAG
AGTTGCCCCAATTTTGAGGCCATCGTGAGCAGGAAAGTGAAGGAATGGATTAAGAAGGACTATACTTTGGCACCAGCCCTGATGAGGTTGCATTTCCACGACTGCGTCGTCAGG
GGATGC
GACGCGTCGATACTATTGAACTACCCAGGGAGCGAGAGGAGCGCCGCAGAGAGCAAGACTCTCAGGGGGTTCGAGGTGATCAACGACATAAAGGTAGCGCTTGAGAAGAGCTGCCCGAAG
ATGGCGTCGTGCGCTGACATCCTGACCTCGGCCGCGAGGGACGCCACCGTGTTGGCCGGCGGGCCGTTCTGGATGGTCCCGTACGGGCGCAAGGATGGGAGGGTCTCCGTCGCCAAGGAG
GCCAGCAAGGTGCCGGTTGGCCACGAGAACGTCACGTCTCTCCTCCAGCTTTTCCAATCCCAAGGATTGAATGTCCTTGACTTGGTTGTTCTCTCAG
GCGCGCACACGATAGGGCGAAGC
ACCTGCGGGTCCATCCAATCGCGGCTCTACAACTACAAGTCCACCGGAAAACCCGACCCGACCCTCAACCGGGAGTACGGGAACTACCTGAAGCGGAAGTGCCGGTGGGCGTCGGAGTAC
GTGTACCTCGACGGGAGGACCCCGAAAACCTTCGATAACATGTACTACAAGAACTTGCAGAAGAAGATGGGCCTCCTCTCCACCGACCAGTACCTCAACTCCGACTCCCGGACCGGGCCG
CTCGTGTCGGCGCTCGCCACCCAGCCCGAGCTCTTCAACTACCAGTTCGGCGTCTCCATGGCCAAGCTCGGCAACGTCCAGGTGCTCACCGGCGACGAAGGCGAGGTCCGCACCAACTGC
AACGCCGTCAACCGCTAC

Retrieve as FASTA