1. Browse the Database
  2. View Redoxidase
Entry information : OsPrx89(LOC_Os06g46799)
Entry ID 1099
Creation 2006-06-26 (Filippo Passardi)
Last sequence changes 2006-06-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-11 (Christophe Dunand)
Peroxidase information: OsPrx89(LOC_Os06g46799)
Name OsPrx89(LOC_Os06g46799)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Pannicles
Shoots
Inducer Fungus infection
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx89
start..stop		 S start..stop
TaPrx18-1A 549 0 26..333 23..330
TaPrx18-1D 546 0 26..333 23..331
TaPrx18-1B 545 0 30..333 26..330
TaPrx101-1A 528 0 5..334 4..332
Gene structure Fichier Exons►


exon

Literature and cross-references OsPrx89(LOC_Os06g46799)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1K4
DNA ref. GenBank:   NC_008399.1 (28030415..28041570)
Protein sequence: OsPrx89(LOC_Os06g46799)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337
PWM (Da):   %s   35768.17 Transmb domain:   %s   i7-29o
PI (pH):   %s   5.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMAAPLTLVVVAAAVAVVFVGGGVEGWVLKEGFYEQSCPRAEALVKHYVEQHVPLAPSVAATLIRTHFHDCFVRGCDASVLLNGTDGAEAEKDAAPNLTLRGFAFIDRIKSVVESECPG
VVSCADILALATRDAISVIGGPFWRVATGRRDGRVSIKQEALDQIPAPTMNFTDLLSSFQSKGLDLADLIWLSGAHTIGIAHCNSFSKRLYNFTGKGGPGDADPSLDAEYAANLRRSKCA
APSDNTTIVEMDPGSFLTFDLGYYRGLLRRRGLFQSDAALVTDAAAEANIASVVSSPPEVFFQVFARSMAKLGMVGVKTGSEGEIRKHCALVNDIHY

Retrieve as FASTA  
Remarks chromosome 6. 10 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST