Entry information : OsPrx89(LOC_Os06g46799)
Entry ID 1099
Creation 2006-06-26 (Filippo Passardi)
Last sequence changes 2006-06-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-11 (Christophe Dunand)
Peroxidase information: OsPrx89(LOC_Os06g46799)
Name OsPrx89(LOC_Os06g46799)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Pannicles
Shoots
Inducer Fungus infection
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx89
start..stop
S start..stop
SiPrx29 511 0 30..333 25..328
SofPrx01 510 0 30..333 27..329
SbPrx139 506 0 30..333 27..329
ZmPrx20 505 0 30..333 24..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28030409..28030633 225 N° 2 28030730..28030921 192 N° 3 28031003..28031165 163 N° 4 28041140..28041573 434
join(28030409..28030633,28030730..28030921,28031003..28031165,28041140..28041573 )


exon

Literature and cross-references OsPrx89(LOC_Os06g46799)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1K4
DNA ref. GenBank:   NC_008399.1 (28030415..28041570)
Protein sequence: OsPrx89(LOC_Os06g46799)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337
PWM (Da):   %s   35768.17 Transmb domain:   %s   i5-27o
PI (pH):   %s   5.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMAAPLTLVVVAAAVAVVFVGGGVEGWVLKEGFYEQSCPRAEALVKHYVEQHVPLAPSVAATLIRTHFHDCFVRGCDASVLLNGTDGAEAEKDAAPNLTLRGFAFIDRIKSVVESECPGVVSCADILALATRDAISVIGGPFWRVATGRRDGRVSIKQEALDQIPAPTMNFTDLLSSFQSKGLDLADLIWLSGAHTIGIAHCNSFSKRLYNFTGKGGPGDADPSLDAEYAANLRRSKCAAPSDNTTIVEMDPGSFLTFDLGYYRGLLRRRGLFQSDAALVTDAAAEANIASVVSSPPEVFFQVFARSMAKLGMVGVKTGSEGEIRKHCALVNDIHY

Retrieve as FASTA  
Remarks chromosome 6. 10 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGGCCGCGCCGCTGACGTTGGTGGTGGTGGCGGCGGCGGTGGCCGTCGTCTTCGTCGGCGGCGGCGTGGAGGGGTGGGTGCTCAAGGAGGGGTTCTACGAGCAGAGCTGCCCG
CGCGCGGAGGCGCTGGTGAAGCACTACGTGGAGCAGCACGTCCCCCTCGCCCCCTCCGTCGCCGCCACCCTCATCCGCACCCACTTCCACGACTGCTTCGTCAGG
GTAAGCGCGTATAGC
TCGTCGATCGATCGGCGTGGCGCGGCGGCGGAATTCTGACGGCGGCGACGGCGGCCATGGCGTGGTGGTTTTGAATTGTAGGGGTGCGACGCGTCGGTGTTGCTGAACGGGACGGACGGG
GCGGAGGCGGAGAAGGACGCGGCGCCGAACCTGACGCTGCGGGGGTTCGCCTTCATCGACCGCATCAAGAGCGTGGTCGAGAGCGAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTC
GCGCTCGCCACCCGCGACGCCATCTCCGTCATC
GTAAGCTAGCACCTCGCTCCTCCTCCTCCTCCTCTCCCGCATTTGCGATGGCCGGCGAGCTGGCTGACGGCGAGCGAGCAGGGCGGG
CCGTTCTGGCGGGTGGCGACGGGGCGGCGCGACGGGAGGGTGTCGATCAAGCAGGAGGCGCTGGACCAGATCCCGGCGCCGACCATGAACTTCACCGACCTCCTCTCCTCCTTCCAGAGC
AAGGGCCTCGACCTCGCCGACCTCATCTGGTTGTCAG
GTAAACTAACTATTCACTCTTCCATATATTAATTTCAGTATTAATTTCACCATCCATTTCAGAGTTCAGACTTCACCATCAAT
AGTATTTCCTTCGTTCCAAAACAACTATAAGTTTCCGCGCCCAACTTTAATCGTCCATCTTATTTAAAATTTTTTTATAATTAGTATTTTTGTTATTATAAGATGATAAAACATGAATAA
TATTTTACTCGTAACTTATGTTTTTAATTTTTTTCAAAAAAAAATTCAAATAAGACGGACGGTCAAAGTTGAACGCGGAAAACCATGGCTGTACTTAAAATGGGACGGAGGGAGTAAACA
TTTTTAGACTTTGACATAGTCTTTGAGATGGTATTTTGATCAACAATATCTATAAAAGTGAGATGTTTTAAATAAAAAAAAGTTGTAATAGTTTGTTAATGATAAGTCTAGTAACATCAA
TTTTACATGATTGATTTTTTTTTATTTTTTTACTATTAATAGTTAAAATTAAAAATGTTTGACTTGACACTATTCTAAAATTGCTTATATTTTGAAAATTAGTTGCGGTCGATCAAAACC
CCAGTTTCAGCTTATGACAGCATCGTTTCTGAAAAGAAAAGTAAAACCATTCACCTAAGCTAATGATTGGTTAACTTGACACAAACGGCAGCCAAAGATCGATTTTCACGTTATATCCTA
ATTAAGTCGATTGATTACTAGTCTTCAGGATACACAACTCGATCAGGTTTGGTGTTTTATCTAGCTTGATGTAGCTAGCTATGTGGTGTTTGCAAATGCGTAGTACAAGCCACCGACAAA
TAGTGAATTGGTGATGTGATATCGTGCTGCAAAATCTGCAATATGCAGAGAACGATAGTTAACTTTTGCAAATTCTTTGTGTGTTGAGTCGGCAACTAGGACACGCTCTCACTCTCACTC
ACATCACACCCCAGTAATGCTGTCCCCAAAGATTCAGAAGATGAAAGATATATAGCCTCAATCACACCGATTTCCATGTAGTAACAATACTAACAAACAACGATCCTAATAGGAACACTA
CAGATGCCGAATTTCTATCCATTATCTAAAAAACTCTCGTGCCACGACAATCCAGAATTGAACAGACAGCTACGTCCAACAGGGAGGGTTGGATCTACTTAATTCATAGAAGGCCAAAAC
TTAGCTGAATCTTGTTCACGGGTATCGCATCAAATCAAAGTTAAAAACAGTTTAGTAGGTATAGCGATCTAACCAACAGATAACGAGGCTTTTAGTTGACGGCTGGCAAGTCTGTTCCGT
GCAATAAAATGCAATTCATAACACTGCACTATAACAAATATATCTTATAGAGATATTTTCATTTTTCTAATACTATAGAGGCATTTTTAAAATGCCTTTACAATGTTATAGAGACATTTT
GAAGAGTGTCTCATAAGTGCCTTTTGGTGAATTGTCGCATTTTTAAAATGCCTTTACAGTGTTATAGAGACATTTTGAAGAGTGTCTCATAAATACCTTTTGGTGAATTGTCTCTACAAA
CTAAGAGGTGAATTGTCTCTACGAACTAAGAGGACATTTTGAAGAGTATCTCATAAGTGCCTTTTGGTGAATTGTTTCTACGAACTAAGAGGCATTTTATAAGATGTCTCTATGCAAATA
GAGGCACGCACTAACCATCTCAACCTCATATAATTATATGTAAGTATGTGATTTGTGTTACTTATATCTAGTTACTTGATATATATTAATATTTGAAAAAATGCCTTTACATCGTTTTAA
ATGCCTTAAGAAAATGCATTTACATATGAGACAAATTTTAAAGTGCCGAAAATGTGTCTCTACGAGATAAACTTAACAAAGTATACTAAAAATGTCTCTAGAGTAAAAATATTTTAGACG
ATTTTGAAAGTGCCTCTAAAAAGTGTCTCTAGACTATAGAGCTTCAAAACTTAGAGGCATTTTAAAAATTGTCTCTACAAAAGATTCTTTATATAAGGTTTTTGATGTAGTGCTGTTTTA
TTTAGAGAGTGTAGCACAGATATTGACACACTAACTGACCAAGATTTTTATTAACGTTAGTGGTTAAAGGTGTGCAAAAAATGCCAAGACAAACATTCAGCTCTTGTACTGTCCTGTATC
TGTACTTGTGAGTTAGTAGCAAATTAGTAGCTAGCTAGATTCTATAAAAGGGGGGAAGTGATGCAGCTTATATAAGGGAGAAACGTGATGTAACTGGCCTCCTACTTCTCTGAGAGAGTG
ACTATTTACTAATCCTTAATTTGAAAGATCAAGAAATGAGTTACATTGTATTTATTCAATGTGTAAAAGCTGAAATAATATATACATACACGTCAAGTGCAGAGGGCATGCATATGCCTA
CTAGCTGTTGAGATTATGGGCATATAATGATTTAATTTATTCCATAAATAAATCATGACATTACAGATGAAAACTAGCATGAACGCATCATTAGATCTACACATGTAAACTACGTAGAAA
AACATGAACAGACCAAATATGCGCAACATATTGAACACGTACCGAGGTGACGAAAAAACCGGCTGCTTGGTCGAAACTTTTCGCAGGTGTCTACGAAGGCACGAAACACGCGAGCGAAGA
GGAAGGCGAGCCGTCGCGAACGAACAGGGAGCAGTCGCGCGAAGCGCTTCCCAAAAACCTTATTGCCGCCTTCTCCCGGTGCAGGACGTCAAAGGCAGAGGTTCCGGAGACCTGCTCTCC
CGATCGCTGGTGCACGCCGGCGAGCGGGATGGAGTAGTCTACGAGCGACGGCGCAGTACAGAGTAGGAGGCAAACCCTAGATTGATTTTCGCATATATTGCGTGAAGACGGCGGGTCGGT
TTATATAGAGAAGGGTCGCTTGATCAGGGCGCCCGCACGATCTCTACTGCGCGTAACCGAACCGGATAAGTCGCGCGTAACTTATCCGGACTCCACGCCGTTTGCACGCATCGGATTTTT
CGGAACGTTTCCAAAACAAAAACGAATCCGAATTTGCAGCAAAACAAAACTGCAAAAGGAGGCTGCATCTGCGCAAGGGTGAGGAGCCAATTTTTCGGACCATTCGACGCGTACGTCGTG
CACGCGCGCCGCCTGCCCTGCCCTGCCAGGCCAGGCGAGGCGAGGCGAGCGAGCGCGCGTGTGTTTCCCCTCTTCTCTCCACCACACATGCTTCAAGTGGCTAGGAGGGCATCCTCCCTT
TTAAGGAGGTCCCCCTCTCCTAGAATAAGCAAGGTGGTACTAAACTCCACATGCATGCCATCCTATGAGGTGGGCTTTTGTGATTTTCCAAAGAATTAATCTTCGAGTGGGCTAAGGCCC
ATTCATTAATTCCAACAATCCCCCACCAAATCTCAAAATCCCACTGAGATTTGCCTTTTCCAATGTACTGTTTATATACCAGCGGTTCGATGGAGACCAATTAAGGTTGAACATCCACCT
AGAACTCCAAGCTACACTTACTCACAACTTGAACAATGGACTACGCCTTGAATTGCAAGTCTTGTGCAAGCAAGTTTCACTCAAAGTCTTATCTGGTACTAGACCGTCTGTAGACTACCC
CTCGGGTGGAGCGTATAAGTCATACTCCTAGGTCTTTAGTAAGCTTCCTAGAAGATTCACCCAAAATCTTCATGGACTGCGACCAACAGTCAAGCTCACAAAGGTGAGTTCCTTCAAGAA
TGCTCTGCAGGACAACATCTTTGCTAATTAAAGCCAACAGAACTCATTAAGGCATAGCCAACCTGCCTTGCAGCTCACGAGAGTATATGCATCTTCACTTAGAGAGGGTATATATATTGG
TACTCTCCTCTAGTTTATTAATGGTTTGTTCTTCCCAGGATCTAATTCACGGGATCTCCGATCACATAGACTGGGTTACCACCATAGTATAACTCACATGGGTCTCAAACCCATCTCCTT
CGATGCATTGTCTATCACATTTCGTGATAGTCCCTTCGTGAAGGGATCTGCCAGGTTTCTCGCTGTTTGGATGTAATCCAACGTTATAACTCCGGAGTTTCTTAATTTCCTGACAGACTT
CAATCGTCTTTTCACATGTCTAGACGATTTCATATTATCCTTAGAACTATTCACTTTGACAATTACCGTTTGATTGTCACAGTTCATAAGGATAGCCGGCACCGGTTTTTCAACAACAGG
CAGATCCATTAATAGATCACGCAACCATTCTGCCTCAACAGTAGCAGTATCCAGTGCCGTTAGCTCTGCTTCCATGGTTGACCTCGTCAAAATTGTCTGTTTGCAAGACCTCCATGAAAC
AGCACCACCACCCAGTGTGAAAACATATCCACTAGTGGCTTTGATCTCATCCACATCAGAGATCCAGTTAGAATCACTATAACCCTCCAGTACCGCAGGATACCCAGTATAGTGAAGCCC
CAATTCCACAGTACCTTTCAGATAGCGCATTACTCGCTCAAGCGCACGCCAGTGATCATCTCCCGGATTAGAGGTAAATCGGCTCAACTTGCTCACAGCAAAGGAGATATCAGGCCTAGT
TGCACTAGCCAGGTACATCAACGAGCCAATGATTTGGGAGTATTCCAGTTGATTCCTAGCAATTCTCTTGTTCTTGCGAAGCGACAAGCTAGGATCATAAGGTGTTGGAGAAGGCTTACT
ATCAATGTAGCCAAAGCGATTCAAGATCTTCTCCACATAATGAGACTGCAAGAGTGTAATCCCATTCTCACCTCTAATTAGCTTAATGTTTAAAATAACATCAGCTACTCCCAAATCTTT
CATATCAAAATTTTGAGACAAGAATGATTTAACCTCATTTATCACCTCAAGGTTTGTCCCAAATATCAGTATGTCGTCAACATACAAGCACAAAATAACTCCCTCACCCCCACCATGGTG
ATAGTACACACATTTATCTGCCTCATTGACTGCAAAGCCTGCAGATGTCAATGTTTTGTCAAATTTCTCATGCCATTGCTTAGGAGCTTGTTTCAGACCATACAAAGACTTCAACAATTT
GCACACTTTGCCTTCTTGACCTTCAAGTACAAACCCATCAGGTTGATCCATATAGATCTCCTCATCCAGCTCTCCATTAAGAAAAGCTGTCTTAACGTCCATTTGATGAACGAGAAGACC
ATGTGAGGCTGCTAGGGAAAGTAGCACACGAATTGTGGTCAATCTAGCAACAGGTGAGTAAGTGTCAAAGAAATCTTCGCCTTCTTTCTGAGTATAGCCCTTAGCAACAAGCCGAGCCTT
GTACTTTTCAATAGTACCGTCAGGCCTAAGCTTCTTCTTGAACACCCACTTGCACCCCACAGGTTTACACCCATAGGGTCGCTCTGTCACCTCCCAAGTCCCGTTAGCGATAATGGAATC
CATTTCACTACGGACAGCCTCCTTCCAGTAGTCTGCATCAGGAGATGCATATGCTTCTGAAATTGACTTAGGAGTGTCATCCACGAGGTACACAGTGAAATCATCACCAAAAGACTTAGC
CGTCCTTTGTCTCTTACTCCTTCGAGGAGCTTCACTGACATCCTCCTCAGAGACAAGTTCATGTGTATGTTCAGTTTGTTCTGGTGGTGTGATTGAACTGGGAATTATTTCAGAGGGTTG
GTTCGAACCACTATGTGTATCCTTCATTGGGAAAAAGCTCTCAAAGAAGGTAGCATCACGAGACTCCATAATTGTACCAACATGCATGTCCGGTACCTCGGATTTAACTATTAAAAATCT
ATAGGCAATGCTATGATGAGCATATCCCAGAAAAACACAGTCCACAGTCTTAGGTCCAAGTTTGCGCTTCTTCGTTATTGGTACATTGACTTTCGCCAAGCACCCCCATGTGCGCAAATA
AGAAAGTGATGGTTTTCTACCAATCCATATCTCATATGGTGTTTTGTCCTTATTTCTGTTAGGAACTCTGTTTAACACATGATTTGAGGTCAACAATGCCTCCCCCCACCATGCCTTAGG
CAGTCCCGCGGTGTCCAACATGGCATTCACCAAGTCAGTCAGTGTGCGGTTCTTCCTTTCAGCAATCCCATTAGACTCGGGAGAATAGGGAGGCGTCCTCTCATGTATGATGCCATGTTC
CTCACAGAATAAGTCAAACTCGTTCGAGAAAAACTCTCCACCACGATCAGACCTAAGCCTTTTTATCTTTCTGTCAAGTTGATTTTCAACTTCTGCCTTATAAATTTTAAAATAGTCTAG
AGCCTCGTCTTTCGTTTTCAACAAGTACACATAGCAAAATCTAGTAGCATCATCAATCAATGTCATGAAATATCGTTTTCCACCCTTCGTCAACACCCCATTCATTTCACAAAGATCTGA
ATGTAGGAGTTCTAGTGGTGCCAAGTTTCTCTCCTCGGCAGCCTTGTGAGGCTTGCGAGGTTGCTTCGATTGCACACAACTATGGCACTTAGAACCTTTGACAATGGAAAACTTAGGAAT
TAAACACATGCTGGAAAGCCGAGACATCAAGCCAAAATTAATATGACATAAACGTGAATGCCAAACATTAGCCTCATCATCCACACTGCCACAAATATGGTTCACAGACTTATTGCAGAA
ATCAGAAAGGGAAAAGCGGAACAGGCCTCCGCACTCATAACCTTTACCAATAAAATATCCATGTTTAGACACGACTACTTTATTAGACTCAAAAACCAACTTAAATCCGTCTCTAGTCAG
ACGGGAGCCACTAACAAGATTCCTGTCGATAGAAGGGACATGCTGCACGTTCTTCAGCTGCACGATCTTTCCCGAAGTAAACTTTAGATCTACCGTGCCAACACCATGAACAGAAGCATG
TGACCCATTCCCCATTAGGACGGTGGAACCCCGTGCGACCTGATAAGAAGAAAACAATGAGATGTCAGCACAAACATGTACATTGGCCCCAGTATCAACCCACCAATTAGTAGATTGATT
AACTGAAAAAACAGTAGGTAAATTACCATACCCGCTTCCATCTCCAGTGTTGCCAATGGTCACATTAGCAGACTTAGAAGTCTGCCCTGCAGGTGCCTTCATCCCCTTGCGTTGTGGACA
CTTCCTAGCCAGATGACCAACTTGGCCACACACAAAGCAAGTCCTCTCATCCTGATTAGGATTGTTGTTGTTCTTCTTCTGCTTCTTGAAGTTGGTGGTCTGCTGAGCTTTGTATTTCCC
CTTGCTCTTGTTCTGGGCCTTGTGCACAACATTGGCACTGGACTGCCCACCATCGCCCTTAGACGCGGCATCTTTTTCCCGAGCTTTCTCCTCAACATCAAGAGACGCAATCAACCCCTC
AACGGAGTATTCCTGTCTCTTGTGTTTGAGTGCAGTACCGAAACTCCTCCAAGATGGAGGTAGTTTTGCAATAATGCACCCGGCCACAAATTTGTCGGGTAAGACACACTTAAGGAGTTC
GAGTTCCTTAGCCATGGTTTGTATCTCATGAGCCTGTTCGACTACAGAACGGTTGTCAGCCATTTTGTAGTCATGAAACTGCTCCATGATATACAGATCATTGCTAGCATCAGTAGCACC
GAATTTAGTATTCAGTGCATCCCATAACTCCTTAGCGTCGGTCATATGCATATACACCTCGACCAGACGATCGCCAAGAACGCTAAGAATGCATCCCACAAAGAGAGTAGTGGCTTCCTC
GAATTGCTTCTGCTGTTCAGCAGTAAGAACTCCTTCAGGTTTGCCAGTACTCACCCAGAAGCATTTCATAGCTGTCAGCCACAGAGTGACCCTGATCTGCCATCTCTTAAAATGCACACC
GGTGAATTTATCCGGCCTCAGTGCATCGGCAAAACCAGCCATAGTAAAATCACAGTGCCTATAATAAGGTTTTTGGATTGTTGAGATTATGGGCATATAATGATTTAATTTATTCCATAA
ATAAATCATGACATTACAGATGAAAACTAGCATGAACGCATCATTAGATCTACACATGTAAACTACGTAGAAAAACATGAACAGATCAAATATGCGCAACATATTGAACACGTACCGAGG
TGACGAAAAGACCGGCTGCTTGGTCGAAACTTTTCGCAGGTGTCTACGAAGGCACGAAACACGCGAGCGAAGAGGAAGGCGAGCCGTCGCGAACGAACAGGGAGCAGTCGCGCGAAGCGC
TTCCCAAAAACCTTATTGCCGCCTTCTCCCGGTGCAGGACGTCAAAGGCAGAGGTTCCGGAGACCTGCTCTCCCGATCGCTGGTGCACGCCGGCGAGCGGGATGGAGTAGTCTACGAGCG
ACGGCGCAGTACAGAGTAGGAGGCAAACCCTAGATTGATTTTCGCATATATTGCGTGAAGACGGCGGGTCGGTTTATATAGAGAAGGGTCGCTTGATCAGGGCGCCCGCACGATCTCTAC
TGCGCGTAACCGAACCGGATAAGTCGCGCGTAACTTATCCGGACTCCACGCCGTTTGCACGCATCGGATTTTTCGGAACGTTTCCAAAACAAAAACGAATCCGAATTTGCAGCAAAACAA
AACTGCAAAAGGAGGCTGCATCTGCGCAAGGGTGAGGAGCCAATTTTTCGGACCATTCGACGCGTACGTCGTGCACGCGCGCCCCCTGCCCTGCCCTGCCAGGCGAGGCGAGCGAGCGCG
CGTGTGTTTCCCCTCTTCTCTCCACCACACATGCTTCAAGTGGCTAGGAGGGCATCCTCCCTTTTAAGGAGGTCCCCCTCTCCTAGAATAAGCAAGGTGGTACTAAACTCCACATGCATG
CCATCCTATGAGGTGGGCTTTTGTGATTTTCCAAAGAATTAATCTTCGAGTGGGCTAAGGCCCATTCATTAATTCCAACACTAGCTAGTAGTTTGCGTCATTGATTCTCAAAATTTTCAT
ACAAATATACCCCCTCCTCCTCACATCGATCTCTTCAAAATCCTTATATTATGGGATGGATGGAGTAGATAGATACTATGTAGTACCAGTGAGCAATGATAGTTGTGATGTAGACATGCA
TCTGCATGCCACAGCTAATTACACCCTCGTGTTGATGTAGTCACGTAGATGTCAGCGTTAAATGGATGTTTTGATGTTTTCTGAAGTTGTAGTATAGTACTCCGTAGTAGGTCTAACGTT
GCATTCTTAATTAACACTGCATACATATCACTTAAGATATTCCTAGCTTAGCTACCGTCCACATACTTGAGGTTCCTAGCTAGATGACAATACTACGTGCAAGCCATTGCAGGAGCTGAA
TATCTTGTAGTACTTGCGCATAGTTGCATGGTCCAGAAAAACAGATATCCAGTACATCTCTCGTTTTCTCCCATTAATTGCAGAGTACTGGGTATCTGATCAGTTAATGAAATCCGCAAA
CTGCTGAACAACCATCTACCTGTAGATTTCAATTGAGGATTTGGACTAAGATAATATACAAATGGTTTTTAGGTACAAACTTCAGAGAAACTGCACTTGCACTGGTTTTCTATGAAATTC
AACCACTCAGTTTTGTCACCGAACCATTTGAAATGGGTTATTTGGATTATTTTCATATAAGGATAAACTAAATACTTTTAGAAATAAACTTACTTAACAAAATAACAAATACTATGCTGA
GTGAAGAAGTATAGTGCTGTAGAATAAGTAGTTTAGAAGCAATATCATAGAAAAAAAAGTTTTTCGAGAAAACATTTCTTTTTAGACGTGGAGTAAATAATCTAATATAGTAATTGAAAA
GCACTCTCTTCGTTTTTTTAATGAATAACACTGTTCACTTTTAAACATATATTTTATCATTCATCTATTAAAAAAATTTTATGTAAATGTATAAGATATAAATCATGCTTAAAATACTTT
AAGTGATAAAACAACTAACAACAAAATAAATTATAATTACGTAAATTTTTAAAAAGATGAATGGTTAAACATGTGATAAAAAGTTAACGGTGTCATTTATTAAAAAACGAACGAAGGTAG
TAGATGCTTTTAATTTACTTCTGAACTCACTAATTGAGTTGATGGGTGCAGGGGCGCACACGATCGGCATCGCGCACTGCAACTCGTTCAGCAAGCGGCTGTACAACTTCACCGGGAAAG
GCGGCCCCGGCGACGCGGACCCGTCGCTGGACGCGGAGTACGCGGCGAACCTGCGGCGGAGCAAGTGCGCGGCGCCGTCGGACAACACGACGATCGTGGAGATGGACCCGGGCAGCTTCC
TCACCTTCGACCTGGGCTACTACCGCGGCCTCCTCAGGCGCCGCGGTCTCTTCCAGTCCGACGCCGCCCTCGTCACCGACGCCGCCGCGGAGGCCAACATCGCCAGCGTGGTGTCCAGCC
CGCCGGAGGTGTTCTTCCAGGTGTTCGCGAGGTCCATGGCGAAGCTGGGCATGGTCGGCGTCAAGACCGGCTCCGAGGGCGAGATCAGGAAGCACTGCGCCCTCGTCAACGACATCCACT
ACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATGGCCGCGCCGCTGACGTTGGTGGTGGTGGCGGCGGCGGTGGCCGTCGTCTTCGTCGGCGGCGGCGTGGAGGGGTGGGTGCTCAAGGAGGGGTTCTACGAGCAGAGCTGCCCG
CGCGCGGAGGCGCTGGTGAAGCACTACGTGGAGCAGCACGTCCCCCTCGCCCCCTCCGTCGCCGCCACCCTCATCCGCACCCACTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCG
GTGTTGCTGAACGGGACGGACGGGGCGGAGGCGGAGAAGGACGCGGCGCCGAACCTGACGCTGCGGGGGTTCGCCTTCATCGACCGCATCAAGAGCGTGGTCGAGAGCGAGTGCCCCGGC
GTCGTCTCCTGCGCCGACATCCTCGCGCTCGCCACCCGCGACGCCATCTCCGTCATC
GGCGGGCCGTTCTGGCGGGTGGCGACGGGGCGGCGCGACGGGAGGGTGTCGATCAAGCAGGAG
GCGCTGGACCAGATCCCGGCGCCGACCATGAACTTCACCGACCTCCTCTCCTCCTTCCAGAGCAAGGGCCTCGACCTCGCCGACCTCATCTGGTTGTCAG
GGGCGCACACGATCGGCATC
GCGCACTGCAACTCGTTCAGCAAGCGGCTGTACAACTTCACCGGGAAAGGCGGCCCCGGCGACGCGGACCCGTCGCTGGACGCGGAGTACGCGGCGAACCTGCGGCGGAGCAAGTGCGCG
GCGCCGTCGGACAACACGACGATCGTGGAGATGGACCCGGGCAGCTTCCTCACCTTCGACCTGGGCTACTACCGCGGCCTCCTCAGGCGCCGCGGTCTCTTCCAGTCCGACGCCGCCCTC
GTCACCGACGCCGCCGCGGAGGCCAACATCGCCAGCGTGGTGTCCAGCCCGCCGGAGGTGTTCTTCCAGGTGTTCGCGAGGTCCATGGCGAAGCTGGGCATGGTCGGCGTCAAGACCGGC
TCCGAGGGCGAGATCAGGAAGCACTGCGCCCTCGTCAACGACATCCACTACTAG

Retrieve as FASTA