Entry information : ZmaPrx06 ( Zosma331g00130 [2.2])
Entry ID 11007
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2016-04-07 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-07 (Achraf Jemmat)
Peroxidase information: ZmaPrx06 ( Zosma331g00130 [2.2])
Name (synonym) ZmaPrx06 ( Zosma331g00130 [2.2])
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Zosteraceae Zostera
Organism Zostera marina    [TaxId: 29655 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmaPrx06
start..stop
S start..stop
ZmaPrx29 688 0 18..354 1..337
PotacuPrx15 490 8.49e-176 19..353 4..340
ZmaPrx37 488 4.03e-175 19..349 3..325
PotacuPrx35 483 5.86e-173 40..353 23..337
Gene structure Fichier Exons


exon

Literature and cross-references ZmaPrx06 ( Zosma331g00130 [2.2])
DNA ref. Phytozome 12:   scaffold_331 (75788..77059)
Cluster/Prediction ref. Phytozome Gene 12:   33172184
Protein sequence: ZmaPrx06 ( Zosma331g00130 [2.2])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353
PWM (Da):   %s   39244.78 Transmb domain:   %s   i21-43o
PI (pH):   %s   8.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKNNTTIFFVSISCKVNIARMRLVVATLALALMLNPSFLNSMVDSSNVAQFLYPEFYQCSCPNAAEIVRSVVAKAMAREARMAASLLRLNFHDCFVQGCDASLLLDSTDKIVSEKGSKPN
KNSARGFEVIDEIKMALEKECPRTVSCADIIALAARDSTVLSGGRNWEVPLGRKDSHEASLKESNNNIPAPNSTLKTIIAKFKRQGLSEVDVVALSGSHTIGMSRCVSFRQRLYNQTGNH
QPDRTLDSHYASFLRTGCPKSGSDQNLFLLDFQTPAKFDNFYFKNLLTNNGLLNSDEVLFTQSEFTKGLVKLYAENNDIFLDQFAKSMIRMSTVKPLTGDKGEVRENCRFNNH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
CDS
Send to BLAST