Entry information : ZmaAPx01 ( Zosma123g00790 [2.2])
Entry ID 11009
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2016-04-07 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-07 (Achraf Jemmat)
Peroxidase information: ZmaAPx01 ( Zosma123g00790 [2.2])
Name (synonym) ZmaAPx01 ( Zosma123g00790 [2.2])
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Zosteraceae Zostera
Organism Zostera marina    [TaxId: 29655 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmaAPx01
start..stop
S start..stop
NtAPx03-1B 443 2e-160 1..250 1..250
NtAPx03-1A 443 3e-160 1..250 1..250
TcAPx01 442 3e-159 1..250 44..293
NtAPx03-1A_unknown 440 3e-159 1..249 1..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 464460..464578 119 N° 2 464659..464833 175 N° 3 464928..464993 66 N° 4 465082..465130 49
N° 5 465195..465280 86 N° 6 465342..465421 80 N° 7 465508..465610 103 N° 8 465681..465739 59
N° 9 465843..465858 16  
join(464460..464578,464659..464833,464928..464993,465082..465130,465195..465280, 465342..465421,465508..465610,465681..465739,465843..465858)


exon

Literature and cross-references ZmaAPx01 ( Zosma123g00790 [2.2])
DNA ref. Phytozome 12:   scaffold_123 (464460..465858)
Cluster/Prediction ref. Phytozome Gene 12:   33177944
Protein sequence: ZmaAPx01 ( Zosma123g00790 [2.2])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   27320.82  
PI (pH):   %s   5.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKCYPDVGEEYQKAVEKCKRKLRGVIAENNCAPIMLRIAWHSAGTYDVKTKTGGPFGTMKMKTELAHGANNGLIIAVNILDPIKDLFPILSYGDFYQLAGVVAVEVTGGPDVPFHPGRKDKNDPPVEGRLPDATQGADHLRQVFVTQMGLSDKDIVALSGGHTLGRCHKDRSGFEGPWTANPLIFDNSYFKELLAGEKEGLLKLPTDNVLLSDPVFRPLVDKYAADEDAFFADYAESHQKLSELGFADA*

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGTGTTACCCCGATGTTGGTGAGGAGTACCAGAAGGCTGTGGAGAAATGCAAGAGGAAGCTCCGTGGAGTCATCGCCGAGAACAATTGCGCTCCGATCATGCTCCGTATCGCG
TACTGTTTTGTCTTTTTTATTTTTCCTATCCACTGTTGTCTTCGTCGTTTATTCAATTATTTTTCTTCTTTTTTGGTAGGTGGCACTCAGCCGGTACCTATGACGTGAAGACGAAGACCG
GCGGACCTTTTGGAACGATGAAGATGAAAACCGAGTTAGCTCACGGTGCGAACAATGGACTTATTATCGCTGTCAATATTCTTGATCCTATCAAGGATCTCTTCCCGATCTTGTCTTATG
GTGATTTCTACCAG
GTTCGATCTCACAATATATTTTTCCAACAGTCGATTCTCGATTCCTTCATTGATTGGTAGTTATGTAAAATGGTGTCTTGTTTTTTCTTCTTAGCTTGCTGGAGTG
GTTGCGGTTGAGGTTACTGGTGGGCCGGATGTTCCTTTCCATCCTGGGAGAAAG
GTAAAACCTTTTCTGTGTGATCCACATCAATTTATATATGTTCACGACTGTCATTCCTCATTCCTA
TATTGTCTATTGAGATCATCAGGACAAGAATGATCCACCTGTGGAAGGACGCCTGCCTGATGCTACCCAAGGTCTGTGCATAAGCACATGTTTCTCTTTCCCATAGCCTTCGTTATTAAC
TATTTTTAATCTCAGGTGCGGATCATTTGAGACAAGTTTTTGTAACCCAAATGGGACTTTCCGATAAGGATATCGTTGCCCTCTCTGGTGGTCACACCCTGGTAAGTTCTTATTTTGATC
AATACTTATTGGAAAATGGTCTGAAAACTTTTCGTTTTGTAGGGTCGTTGTCACAAGGATCGGTCTGGTTTTGAAGGACCATGGACTGCCAATCCTCTCATCTTTGACAACAGTTACTTC
AA
GTATGTTTCTTTTTAAAATGTCCATTTATTTGATGCTTTAGTACAAAAATTGAATACTTTTTCCTTTGCTATATTTTATTCCACAGGGAACTACTTGCAGGAGAGAAAGAAGGGCTTC
TTAAACTTCCAACTGACAATGTTCTGCTGTCCGACCCGGTGTTCCGCCCTCTTGTTGATAAATATGCTGCG
GTATGCTCGTTTTCTATCAACTTTGCTTTTTTCTGATTGGAAAATTAAT
TTTACTTGTTTTTGCTTAAAGGATGAGGATGCTTTTTTTGCCGATTATGCTGAATCTCACCAAAAGCTCTCTGAGCTGGGGTCAGTATCTTTTTTTCTTTTATAAATTTTCTTTTTTTTT
CTTTTATAAATTTTCTTTTTCTTCTTCTCTGGCTTATACTGATTATTATTATTTTTCCTTCAGATTTGCTGATGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAGTGTTACCCCGATGTTGGTGAGGAGTACCAGAAGGCTGTGGAGAAATGCAAGAGGAAGCTCCGTGGAGTCATCGCCGAGAACAATTGCGCTCCGATCATGCTCCGTATCGCG
TGGCACTCAGCCGGTACCTATGACGTGAAGACGAAGACCGGCGGACCTTTTGGAACGATGAAGATGAAAACCGAGTTAGCTCACGGTGCGAACAATGGACTTATTATCGCTGTCAATATT
CTTGATCCTATCAAGGATCTCTTCCCGATCTTGTCTTATGGTGATTTCTACCAG
CTTGCTGGAGTGGTTGCGGTTGAGGTTACTGGTGGGCCGGATGTTCCTTTCCATCCTGGGAGAAAG
GACAAGAATGATCCACCTGTGGAAGGACGCCTGCCTGATGCTACCCAAGGTGCGGATCATTTGAGACAAGTTTTTGTAACCCAAATGGGACTTTCCGATAAGGATATCGTTGCCCTCTCT
GGTGGTCACACCCTG
GGTCGTTGTCACAAGGATCGGTCTGGTTTTGAAGGACCATGGACTGCCAATCCTCTCATCTTTGACAACAGTTACTTCAAGGAACTACTTGCAGGAGAGAAAGAA
GGGCTTCTTAAACTTCCAACTGACAATGTTCTGCTGTCCGACCCGGTGTTCCGCCCTCTTGTTGATAAATATGCTGCG
GATGAGGATGCTTTTTTTGCCGATTATGCTGAATCTCACCAA
AAGCTCTCTGAGCTGGG
ATTTGCTGATGCTTAA

Retrieve as FASTA