Entry information : EglKat[P]11
Entry ID 11020
Creation 2012-05-16 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EglKat[P]11
Name EglKat[P]11
Class Catalase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglKat[P]11
start..stop
S start..stop
EcamKat[P]06 191 2.64e-63 1..103 1..123
EgrKat[P]04 165 3.05e-51 1..103 2..153
EguKat[P]04 165 4.68e-51 1..103 1..152
EcamKat[P]11 154 6.23e-51 1..86 1..99
Gene structure Fichier Exons


exon

Literature and cross-references EglKat[P]11
Protein sequence: EglKat[P]11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   102
PWM (Da):   %s   11723.13 Transmb domain:   %s   i5-27o
PI (pH):   %s   9.26
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
QTIIYVTGPILLDDYHLVEKLANFDRERIP*SAVHARGACAKGFFEVTHDISHLTRAVRFSILIHERGGPETLRDPRGSRVNPKSRIQENWRILDFFFHHPES

Retrieve as FASTA  
Remarks Pseudogene from NGS. Short PS with stop in it.
DNA
Send to BLAST
CDS
Send to BLAST