Entry information : EglRboh01
Entry ID 11032
Creation 2012-05-18 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-16 (Christophe Dunand)
Peroxidase information: EglRboh01
Name EglRboh01
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglRboh01
start..stop
S start..stop
EgrRboh01 1654 0 1..856 1..925
EguRboh01 1627 0 1..856 1..925
EcamRboh01 1622 0 68..856 1..789
VvRboh07 1367 0 3..856 10..917
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..63 63 N° 2 181..207 27 N° 3 298..604 307 N° 4 735..891 157
N° 5 1629..1677 49 N° 6 1894..2007 114 N° 7 2136..2558 423 N° 8 2947..3330 384
N° 9 3431..3526 96 N° 10 3715..3830 116 N° 11 3915..4085 171 N° 12 4173..4329 157
N° 13 4413..4601 189 N° 14 4709..4837 129 N° 15 5029..5107 79 N° 16 5591..5700 110
join(1..63,181..207,298..604,735..891,1629..1677,1894..2007,2136..2558,2947..333 0,3431..3526,3715..3830,3915..4085,4173..4329,4413..4601,4709..4837,5029..5107,5 591..5700)


exon

Literature and cross-references EglRboh01
Protein sequence: EglRboh01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   856 (313)
PWM (Da):   %s   96317.31 (33670.8) Transmb domain:   %s   o295-317i376-395o431-453i476-498o508-522i658-675o
PI (pH):   %s   9.48 (8.35) Peptide Signal:   %s   cut: 37 range:37-349
Sequence 897
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSKRSSYSRGFDLPEEFDDELEDDSIVVRRNLSVTTRIRRKFPWLRSGSSRAGSxxxxxxxAAAAREARRARAQLDRSRSSAQRALKGLRFISKANFCARDAEELWRQVEARFHRLARDGLLAREDFGECIGMDSKEFAVGMFDAxxxxRRQRIGKITREELHDFWLQISDQSFDARLQIFFDMADSNEDGRITRAEVQELLMLSASANKLSKLKERAEEYASLIMEELDPENLGYIELWQLETLLLQKDTYMNYSRTLSTTSLGWSQNLSSFRPTDKVRRICSSLRCLVLENWQRGWILLLWAIVMGCLFAWKFIQYRNMAAFHVMGYCLATAKGAAETLKLNMALILLPVCRNTLTWLRSTRARSFIPFDDNINFHKIIACAIVIGIILHAGDHLACDFPRLVNSSPEKFALISSDFNNRKPTYTDLLSGVEGVTGIAMVVLMAISFTLATHRFRRNIVRLPAPFNRLTGFNAFWYSHHLLGVVYVLLLIHGTFLYLVHEWYMKTTWMYISIPLLLYILERSMRACRSNHYAVRILKVSVLPGNVFSIIMSKPQGFKYRSGQYIFLQCPTISPFEWHPFSITSAPGDDYLSVHIRTVGDWTQELKKTLTEGRDSSCVIGRAKFTxVGCINQTGQPKLLVHGPYGAPAQDYRNYDVLLLVGLGIGATPFVSILRDLLSNTRAEEQMDSITETSRSDDSTNSFASSNVTPGSKRKSQRTSSAHFYWVTRESGSFEWFKGVMNEVAEMDHKGQIELHNHLTSVYEEGDARSTLITMVQALNHAKHGFDILSGTRVRTHFGRPNWREVFIKVASKHPYTTVGVFYCGMPMLAKELRKLSHELSHKTSTRFEFHKELF

Retrieve as FASTA  
Remarks Complete sequence from NGS. Short PS is missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGGTCGAAGCGGTCCAGCTACAGCCGCGGGTTCGACTTGCCCGAGGAGTTTGACGACGAGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGGCGGGGCAATGCTGCCCG
TGTTCCTCAACGACCTGCGGCAGAACTCGCAGCAGGACCTCGTGGAGGTCACCCTCGAGCTCGAGGACGACTCCATCGTCGTCCGCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAGGAACCTGTCGGTCACGACGAGGATCCGGAGGAAGTTCCCGTGGCTGCGGTCCGGGTCGTCGC
GGGCCGGCTCNNNNNNNNNNNNNNNNNNNNNNGCGGCGGCCGCGAGGGAGGCGCGGAGGGCGAGGGCGCAGCTGGACCGGAGCCGGTCGAGCGCGCAGAGGGCGCTGAAGGGTCTCCGGT
TCATCAGCAAGGCCAACTTCTGCGCCAGGGACGCCGAGGAGCTCTGGCGCCAGGTCGAGGCCCGCTTCCACCGCCTCGCCAGGGACGGCCTGCTCGCCCGCGAGGACTTCGGCGAATGCA
TCG
GTACGTTCTCCAAATCCCATCGCCATCGTTACAGTAGTGCATGCGAGACGTGGTGAAATGTGTGCGGACGGGTTGCGAAGGAAGTTGACGGTTGGCGGCGGTGGGTTTTGCTTTGCT
GTTGGAAAACCAGGGATGGACTCGAAGGAGTTCGCGGTGGGGATGTTCGACGCGNNNNNNNNNNNGCGGCGGCAGAGGATCGGGAAGATCACCAGGGAGGAGCTGCACGACTTCTGGCTC
CAAATCTCCGACCAGAGCTTCGACGCGCGGCTTCAAATATTCTTCGACAT
GTGGGCCCCCCTCTCCCTGTCTCTCTTTATCTCTCGATTCGTCTAGCCGTTTCGTGACCGTTCGATCGGA
TCGGAGCGATGGCTTCCTGGCCTCGTTGACCGTGCCTTTTCGATCGATCTGACGGCGGGGGATGCGGAATCCGAGGCAGGCCCGGCCGCCCCCTGGCCGCATGATCTCGCNNNNNNNNNN
NNNNNNNNNNCTCTCGGGATGATCGCCGGCGTATTAATTGCCTGACAGAAAGAAAAGACGAGAAGTGTCGTTGAAGCTTTAATTTACTTGTCGGACTCCATTGATTATTATTACCCGCGA
AAAGTGAAGTACATTGAATGTTACTTTTTGAAGAGCAAAAAGGATTTTGTCCAAATGGATTTTTGGTAGTGAATTTCGTGATTTTGAATGTACCCTTTCTTTGTCTTTTTACGTGTAATC
AACTCGTTGAAAATTAGAATTTATACACTAAGAATAGCAGTTGTTATTAAGATCATGCTAGAGTTATTATTGTCTTGGTCGGGGCCCAAGTCGTCGATAATTGTTGGGAATTTCTGCTTT
CTTGGGTCATGAAAAAATTTAATGCTTTCATTAAAAATGGAGAGGAAAATCTTAGTTATTTTTTTGCGTATTTGAACTAGATTTAGTGTACCTCCTCAATTTACTTGGTAATTCATGTGA
CTTGACAAATGCCCTAAAAGCCCTGATGAAAAGTCCTGACGTGTGTGTATCCTTTGTGCTTTATTAGGGCGGACAGCAATGAAGATGGGAGAATCACCAGGGCAGAAGTACAGGAGGTAG
GACTTTGTTCTTCCTCATCTGCAATTTCGAGTTTTGTCATCACATTACTCGAGCGTTATCAGCAGCGTGTCGTCCTTCTTTTAAGCTTGTCCATGTAGACATGAATGGTACTTCCGGCTC
ACTAGCGAGATGATGCATCGGTTGTAGCTAAGAAAGAATGAACTGTTTCGTTTTACCGACACTTTGGAGCTTCACCAATGTCTTGATTTCAGCTTCTGATGCTCAGTGCATCAGCTAACA
AGTTGTCGAAGCTGAAAGAGCGAGCGGAGGAATACGCCTCCCTGATCATGGAGGAACTGGACCCGGAGAACCTCGGCTACATCGAG
GTAAAAGCCCCTGAAGCGGCAAAGCAAAACATAG
ATGACATAGGATATTCAACTTAGGAAAACTCTTTGCTCCATGGAAAGAAGTACTAATTCAGACAGCCTATCATTTGCCCTGTCCTCTGTTTCAGTTGTGGCAACTGGAGACTCTGCTTCT
GCAAAAGGACACTTATATGAACTACAGCCGAACGCTCAGCACGACCAGTCTTGGCTGGAGCCAAAACCTGAGCTCGTTTAGACCGACCGACAAGGTGCGGAGGATTTGCAGCTCCCTCCG
ATGCCTCGTGCTGGAGAACTGGCAAAGAGGTTGGATTCTGTTGCTTTGGGCGATAGTGATGGGGTGCCTCTTCGCTTGGAAGTTCATCCAGTACAGGAACATGGCAGCATTTCACGTAAT
GGGCTATTGCCTGGCGACGGCCAAGGGGGCAGCAGAAACTCTGAAGCTCAACATGGCTCTCATCCTCCTGCCCGTCTGCCGGAATACCCTGACGTGGCTCCGGTCCACCCGGGCCAGGTC
GTTCATTCCCTTCGATGACAACATAAACTTCCACAAG
GTAAAAGATCTGGCGAAACAAGTAGAAACATCATGCATAGAGTTTTGAAATGTTGGTTCTCAACATCGTATCAATTACTCCTG
GCTGAATTAAATTGGCATGGTTCGAAAACATAGTTTTTCCNNAGAATGGTGAAATTCACTATGGCAGGCAATAGAAATAGAAGATTTAGAAAGAAAGTCTAAAGATTTCAATGGTTGCAA
CTTCCAGGGAATGCAATTCCATTAACATGCATGAGCTAAAGTGCATATGAACATGGCCGAGATATAAAGGAAGTACAGTTGTTCAAAGTGATTATTTCAAGCACTACTGTATTTTAGACC
AACTATATCTCGTGTATGCAAGAGATAATGGAATGACACTCCAGCACTTTTTTCCCAATGCACAGATAATTGCATGTGCCATAGTCATCGGGATCATCCTTCACGCAGGAGACCATCTAG
CATGTGATTTTCCCCGCCTGGTAAACTCCTCCCCAGAAAAGTTTGCCCTCATATCCTCTGACTTCAATAACAGAAAGCCCACATACACGGACCTTCTATCTGGAGTTGAAGGAGTGACGG
GCATTGCTATGGTGGTTTTGATGGCTATCTCATTCACTCTAGCGACACACCGGTTCAGGAGAAACATAGTAAGGCTACCTGCACCTTTCAACAGATTGACAGGTTTCAATGCATTCTGGT
ATTCCCATCACCTGCTAGGTGTGGTCTACGTTTTACTGCTCATCCATGGAACCTTTCTGTACTTGGTGCACGAATGGTACATGAAAACG
GTAAGCAATCCGTCTCATTGTATATGCCGTA
GTTAAGTCAAGACATCAAACTTCATCATGTATTCAATAGCACCGGTACTAATTCAATGCCTTACCTCAGACATGGATGTACATCTCTATTCCATTGTTGCTTTACATACTTGAGAGAAGC
ATGCGAGCATGCAGATCAAACCATTATGCAGTTCGAATATTGAAG
GTAATACCTTTCTTATTTCTCTTACATTTCGACTTTTCATTGTTTGATCAAGAAAAAGGACATAATATAATGCAC
AATTGAGAAAAAAATGCATCAGCGTCTTCATGCACGATCTTCGCAAAGTACATTGAGAAATTTGTTTTTCTGAAAAAAGCTAATTTCTTTTGGACTATGCTTGTTCTCTTCAGGTTTCGG
TTCTACCAGGGAATGTCTTCAGCATAATCATGTCCAAGCCTCAAGGGTTCAAGTACAGAAGCGGGCAGTACATTTTTCTACAATGTCCGACAATTTCCCCTTTTGAGTG
GTAAAGTCCAA
AACTCATCTCACCTCCTAGCTTTTCCAACATCTGCATTTCCACCATCAAAGGCTAAGTGCTGATACCTTCCAGGCACCCATTCTCAATTACTTCAGCACCTGGAGATGACTACCTCAGTG
TTCACATCAGGACAGTTGGTGATTGGACACAGGAGTTGAAAAAAACTCTCACTGAAGGCAGAGACTCGTCATGTGTCATTGGCCGAGCAAAATTCACNNNGGTTGGTTGTATCAATCAGA
CAGG
GTAATTATGTTTCTGGCAGGCTTAAGTTCCGAAATAGAAACTATTCTAGGTAATGCTAACTGAACAAACTGTCATGTCATGATGCAGCCAACCCAAATTGCTCGTCCATGGTCCAT
ATGGAGCTCCAGCTCAGGACTACAGAAATTATGATGTACTGCTCCTCGTGGGGCTTGGCATTGGTGCAACCCCTTTTGTAAGCATCCTTAGAGATCTTCTGAGTAATACAAGAGCAGAGG
AGCAAATG
GTACAGTATGTTGCTAATATATGAACAACGTGTCTTAAAATTTAGGAAACACATCCTAAACTTTTGCTATTGTGATGAACTAGGATTCAATCACAGAGACCAGTAGATCTGA
TGATAGCACAAATAGTTTCGCATCTTCAAACGTGACACCAGGCAGCAAAAGAAAGTCACAGAGGACGTCCAGTGCTCATTTCTACTGGGTGACTAGGGAATCTGGGTCGTTCGAGTGGTT
CAAAGGAGTCATGAATGAAGTTGCAGAAATGGATCACAAA
GTAAAATTCTTCTGAACATTGCTCATGACTGTTTAGTGCACGTGTAGAAGGAACTAAACGAGTGGGCTAAGAGACCCTAT
GTCTTCTCTCTCTTTCTGTATGAGCAGGGTCAAATTGAGCTTCACAATCACCTTACCAGTGTCTATGAAGAGGGAGATGCAAGGTCAACTCTAATCACCATGGTCCAGGCTCTCAATCAT
GCCAAACACGGTTTCGACATCCTATCAGGCACACGG
GTATAATATGATGTCTACATAACAATGCCACATTCCGTTACGTTACCATGTTAACAATGAACACGCTACCGAGACAATTGACTA
GAGACACTATAGATAGAATATTCTTCTCTATTTTTTAGCTCGTTTGTTAAAGTGAACTGCTTCAACCGTGAGGCTGCTAACTCAGTCCTGATATTCGATACTTGCAGGTAAGAACACACT
TTGGAAGACCGAATTGGAGAGAGGTATTTATCAAAGTAGCTTCAAAGCATCCATACACTACAGTAG
GTAAGTGTAAAACAAGAAAGCATTAGTACTTGCTGACAAATTTCATAACAATCA
AACTAAGTAGTTCAGATCCCAGATACAATGAAATTACAAAAACTAGCTTCATTTGTTGCTGGTAATTAATCCTGAAATCATCATACAGGTAGAGCTCAGCACAATAGCCTTCTGATATTA
ACAATAACTAGACAAGACTTACAAATTGACATTAGGTCAGATGTAACTTCTGCAAATAAGAGACTTGTTTTTAAACTTGTAGGAGACCCTTAAACGCACTCTGTGGCCAAGTCTACATCA
GAAAATAATGCGAAGGATCAAAATATAAGATCTTAACTTTTGCGTAAATTATATAATAAAACCCTTGACTAGGAAAGTAAAACCATCTCCTTAACGTAATGAAACTCTACAATGTTTGCT
GAATCTGCAACTGTCGCAAGATACTGACGTTCCAATGATGTCTGAACGAAAGGGGTTTTTCTATTGCAGGGGTGTTCTACTGCGGGATGCCGATGTTAGCAAAGGAATTAAGGAAGCTAT
CGCATGAGCTGAGTCACAAGACATCTACACGTTTCGAATTCCACAAGGAGCTTTTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGGTCGAAGCGGTCCAGCTACAGCCGCGGGTTCGACTTGCCCGAGGAGTTTGACGACGAGCTCGAGGACGACTCCATCGTCGTCCGCAGGAACCTGTCGGTCACGACGAGGATCCGGA
GGAAGTTCCCGTGGCTGCGGTCCGGGTCGTCGCGGGCCGGCTCNNNNNNNNNNNNNNNNNNNNNNGCGGCGGCCGCGAGGGAGGCGCGGAGGGCGAGGGCGCAGCTGGACCGGAGCCGGT
CGAGCGCGCAGAGGGCGCTGAAGGGTCTCCGGTTCATCAGCAAGGCCAACTTCTGCGCCAGGGACGCCGAGGAGCTCTGGCGCCAGGTCGAGGCCCGCTTCCACCGCCTCGCCAGGGACG
GCCTGCTCGCCCGCGAGGACTTCGGCGAATGCATCG
GGATGGACTCGAAGGAGTTCGCGGTGGGGATGTTCGACGCGNNNNNNNNNNNGCGGCGGCAGAGGATCGGGAAGATCACCAGGG
AGGAGCTGCACGACTTCTGGCTCCAAATCTCCGACCAGAGCTTCGACGCGCGGCTTCAAATATTCTTCGACAT
GGCGGACAGCAATGAAGATGGGAGAATCACCAGGGCAGAAGTACAGG
AG
CTTCTGATGCTCAGTGCATCAGCTAACAAGTTGTCGAAGCTGAAAGAGCGAGCGGAGGAATACGCCTCCCTGATCATGGAGGAACTGGACCCGGAGAACCTCGGCTACATCGAGTTGT
GGCAACTGGAGACTCTGCTTCTGCAAAAGGACACTTATATGAACTACAGCCGAACGCTCAGCACGACCAGTCTTGGCTGGAGCCAAAACCTGAGCTCGTTTAGACCGACCGACAAGGTGC
GGAGGATTTGCAGCTCCCTCCGATGCCTCGTGCTGGAGAACTGGCAAAGAGGTTGGATTCTGTTGCTTTGGGCGATAGTGATGGGGTGCCTCTTCGCTTGGAAGTTCATCCAGTACAGGA
ACATGGCAGCATTTCACGTAATGGGCTATTGCCTGGCGACGGCCAAGGGGGCAGCAGAAACTCTGAAGCTCAACATGGCTCTCATCCTCCTGCCCGTCTGCCGGAATACCCTGACGTGGC
TCCGGTCCACCCGGGCCAGGTCGTTCATTCCCTTCGATGACAACATAAACTTCCACAAG
ATAATTGCATGTGCCATAGTCATCGGGATCATCCTTCACGCAGGAGACCATCTAGCATGTG
ATTTTCCCCGCCTGGTAAACTCCTCCCCAGAAAAGTTTGCCCTCATATCCTCTGACTTCAATAACAGAAAGCCCACATACACGGACCTTCTATCTGGAGTTGAAGGAGTGACGGGCATTG
CTATGGTGGTTTTGATGGCTATCTCATTCACTCTAGCGACACACCGGTTCAGGAGAAACATAGTAAGGCTACCTGCACCTTTCAACAGATTGACAGGTTTCAATGCATTCTGGTATTCCC
ATCACCTGCTAGGTGTGGTCTACGTTTTACTGCTCATCCATGGAACCTTTCTGTACTTGGTGCACGAATGGTACATGAAAACG
ACATGGATGTACATCTCTATTCCATTGTTGCTTTACA
TACTTGAGAGAAGCATGCGAGCATGCAGATCAAACCATTATGCAGTTCGAATATTGAAG
GTTTCGGTTCTACCAGGGAATGTCTTCAGCATAATCATGTCCAAGCCTCAAGGGTTCAAGT
ACAGAAGCGGGCAGTACATTTTTCTACAATGTCCGACAATTTCCCCTTTTGAGTG
GCACCCATTCTCAATTACTTCAGCACCTGGAGATGACTACCTCAGTGTTCACATCAGGACAGTTG
GTGATTGGACACAGGAGTTGAAAAAAACTCTCACTGAAGGCAGAGACTCGTCATGTGTCATTGGCCGAGCAAAATTCACNNNGGTTGGTTGTATCAATCAGACAGG
CCAACCCAAATTGC
TCGTCCATGGTCCATATGGAGCTCCAGCTCAGGACTACAGAAATTATGATGTACTGCTCCTCGTGGGGCTTGGCATTGGTGCAACCCCTTTTGTAAGCATCCTTAGAGATCTTCTGAGTA
ATACAAGAGCAGAGGAGCAAATG
GATTCAATCACAGAGACCAGTAGATCTGATGATAGCACAAATAGTTTCGCATCTTCAAACGTGACACCAGGCAGCAAAAGAAAGTCACAGAGGACGT
CCAGTGCTCATTTCTACTGGGTGACTAGGGAATCTGGGTCGTTCGAGTGGTTCAAAGGAGTCATGAATGAAGTTGCAGAAATGGATCACAAA
GGTCAAATTGAGCTTCACAATCACCTTA
CCAGTGTCTATGAAGAGGGAGATGCAAGGTCAACTCTAATCACCATGGTCCAGGCTCTCAATCATGCCAAACACGGTTTCGACATCCTATCAGGCACACGG
GTAAGAACACACTTTGGAA
GACCGAATTGGAGAGAGGTATTTATCAAAGTAGCTTCAAAGCATCCATACACTACAGTAG
GGGTGTTCTACTGCGGGATGCCGATGTTAGCAAAGGAATTAAGGAAGCTATCGCATGAGC
TGAGTCACAAGACATCTACACGTTTCGAATTCCACAAGGAGCTTTTCTGA

Retrieve as FASTA